UK Chemical Suppliers

A directory of where to buy chemicals in the UK including: distributors, industrial manufacturers, wholesalers, raw ingredients, bulk supplies and finished goods for sale.

Search for products or services, then visit the suppliers website for prices, SDS or more information.

Product
Difluorochloroacetic acid Difluorochloroacetic acid. CAS No. 76-04-0. Product ID: C-01308. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Difluoromethanesulfonyl chloride Difluoromethanesulfonyl chloride. CAS No. 1512-30-7. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications. Cenik Chemicals
Cenik Chemicals
Difluoromethyl sulfonyl chloride Difluoromethyl sulfonyl chloride. CAS No. 1512-30-7. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications. Cenik Chemicals
Cenik Chemicals
Difluprednate 1g Pack Size. Group: Bioactive Small Molecules, Biochemicals, Research Organics & Inorganics. Formula: C27H34F2O7. CAS No. 23674-86-4. Prepack ID : 47585639-1g. Molecular Weight : 508.55. Molekula
Difluprednate Difluprednate. CAS No. 23674-86-4. Product ID: C-58596. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Difopein Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Group: Pharmaceutical. Alternative Names: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG. CAS No. 396834-58-5. Pack Sizes: 1 mg. Product ID: BAT-010334. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Difurfuryl disulfide Difurfuryl disulfide. CAS No. 4437-20-1. Product ID: C-34281. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
DIGITAL STOPWATCH, 12mm DIGITAL STOPWATCH, 12mm, UK suppliers of laboratory chemicals wanted Suppliers Needed
DIGITAL STOPWATCH, 24hr DIGITAL STOPWATCH, 24hr, UK suppliers of laboratory chemicals and apparatus needed Suppliers Needed
Digitonin 1g Pack Size. Group: Biochemicals, Research Organics & Inorganics. Formula: C56H92O29. CAS No. 11024-24-1. Prepack ID : 84387497-1g. Molecular Weight : 1229.31. Molekula
Digitoxin 1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C41H64O13. CAS No. 71-63-6. Prepack ID : 60859961-1g. Molecular Weight : 764.94. Molekula
Diglycerine Diglycerine. CAS No. 627-82-7. Product ID: C-58208. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Diglycerol Diglycerol. CAS No. 627-82-7. Product ID: C-24990. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Diglycidyloxyneopentane Diglycidyloxyneopentane. CAS No. 17557-23-2. Product ID: C-54489. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Diglycidyl Terephthalate Diglycidyl Terephthalate (DGT) is a monomeric compound utilized for producing high-thermal resistant polymers. As a cross-linking agent in polymerization reactions, DGT generates robust materials with exceptional stability and durability. Furthermore, its multifunctional properties make it ideal for developing composite materials, particularly in the aerospace and industrial sectors. The capability of DGT to enhance the overall performance of materials is significant, and its applications are diverse. Group: Pharmaceutical. Alternative Names: Bis(2,3-epoxypropyl) terephthalate; Terephthalic acid diglycidyl ester. CAS No. 7195-44-0. Pack Sizes: 500 mg. Product ID: B2699-315506. Molecular formula: C14H14O6. Mole weight: 278.26. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Diglycolic anhydride Diglycolic anhydride. CAS No. 4480-83-5. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Digoxin Digoxin. CAS No. 20830-75-5. Product ID: C-23516. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Digoxin 1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C41H64O14. CAS No. 20830-75-5. Prepack ID : 24736068-1g. Molecular Weight : 780.94. Molekula
Dihydro-3(2H)-furanone Dihydro-3(2H)-furanone. CAS No. 22929-52-8. Product ID: C-58718. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Dihydro-3-(tetrapropenyl)furan-2,5-dione 100g Pack Size. Group: Building Blocks, Organics. Formula: C16H26O3. CAS No. 26544-38-7. Prepack ID : 89985628-100g. Molecular Weight : 266.38. Molekula
Dihydroactinidiolide Dihydroactinidiolide. CAS No. 17092-92-1. Product ID: C-24211. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Dihydroajugapitin Dihydroajugapitin is a diterpenoid compound isolated from the herbs of Ajuga ciliata Bunge. Group: Pharmaceutical. Alternative Names: 14,15-Dihydroajugapitin; (1R,2S,3R,4aR,5S,6R,8S,8aR)-8-Acetoxy-8a-(acetoxymethyl)-5-[(2S,3aR,6aS)-hexahydrofuro[2,3-b]furan-2-yl]-3-hydroxy-5,6-dimethyloctahydro-2H-spiro[naphthalene-1,2'-oxiran]-2-yl (2S)-2-methylbutanoate. CAS No. 87480-84-0. Pack Sizes: 5 mg. Product ID: NP1672. Molecular formula: C29H44O10. Mole weight: 552.7. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydroalpinumisoflavone Dihydroalpinumisoflavone is a flavonoid derivative isolated from the herbs of Erythrina arborescens. Uses: Antibacterial. Group: Pharmaceutical. Alternative Names: 5-Hydroxy-7-(4-hydroxyphenyl)-2,2-dimethyl-3,4-dihydro-2H,6H-pyrano[3,2-g]chromen-6-one. CAS No. 63807-90-9. Pack Sizes: 5 mg. Product ID: NP2447. Molecular formula: C20H18O5. Mole weight: 338.4. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydroartemisinin Dihydroartemisinin is an anti-malarial agent. It is a metabolite of Artemisinin. Group: Pharmaceutical. Alternative Names: 3,12-Epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol, decahydro-3,6,9-trimethyl-, (3R,5aS,6R,8aS,9R,10S,12R,12aR)-; (3R,5aS,6R,8aS,9R,10S,12R,12aR)-Decahydro-3,6,9-trimethyl-3,12-epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol; 3,12-Epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol, decahydro-3,6,9-trimethyl-, [3R-(3α,5aβ,6β,8aβ,9α,10α,12β,12aR*)]-; Alaxin; Artemisinin deriv. DHA; Artenimol; CID 3000518; Cotecxin; Cotexin; DHA; DHQHS 2; Dihydroartemisinine; Dihydroqinghaosu; Dynamax; HC 101C; Salaxin; Santecxin; β-Dihydroartemisinin. CAS No. 71939-50-9. Pack Sizes: 1mg;1g;10g. Product ID: NP5947. Molecular formula: C15H24O5. Mole weight: 284.35. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydro-Axitinib Dihydro-Axitinib is an impurity of Axitinib, a tyrosine kinase inhibitor used for the treatment of kidney cancer. Group: Pharmaceutical. CAS No. 1443118-73-7. Pack Sizes: 10 mg. Product ID: B1370-467094. Molecular formula: C22H20N4OS. Mole weight: 388.49. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydroberberine Dihydroberberine, isolated from the tubers of Corydalis decumbens (Thunb.) Pers, was identified that displayed improved in vivo efficacy in terms of counteracting increased adiposity, tissue triglyceride accumulation, and insulin resistance in high-fat-fed rodents. It is also a potential therapeutic reagent for type 2 diabetes treatment. Uses: Anti-tumor. Group: Pharmaceutical. Alternative Names: 5,8-Dihydro-9,10-dimethoxy-6H-benzo[g]-1,3-benzodioxolo[5,6-a]quinolizine; 9,10-Dimethoxy-2,3-(methylenedioxy)-13,13a-didehydroberbine; Dihydroumbellatine; 9,10-DiMethoxy-6,8-dihydro-5H-[1,3]dioxolo[4,5-g]isoquinolino[3,2-a]isoquinoline; Dihydroumbellatine. CAS No. 483-15-8. Pack Sizes: 10 mg. Product ID: B2703-465605. Molecular formula: C20H19NO4. Mole weight: 337.36. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydro Capsaicin Dihydro Capsaicin is a terpene alkaloid found in Capsicum. Uses: Sterilization. Group: Pharmaceutical. Alternative Names: Dihydrocapsaicin; 6,7-Dihydrocapsaicin; N-(4-hydroxy-3-methoxybenzyl)-8-methylnonanamide; 8-Methyl-N-vanillylnonanamide. CAS No. 19408-84-5. Pack Sizes: 250 mg. Product ID: B2703-465114. Molecular formula: C18H29NO3. Mole weight: 307.43. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydrocarminomycin Dihydrocarminomycin is an anthracycline antibiotic that can be produced by Streptomyces atroviolaceus DS 8938, Str. coeruleorubidus DS 8899, DS 31723, DS 7126 and Str. bifurcus DS 23219. Group: Pharmaceutical. Alternative Names: Carminomycinol; Antibiotic 32999RP; RP-32999; RP 32999; RP32999; (9S)-7-(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy-4,6,9,11-tetrahydroxy-9-(1-hydroxyethyl)-8,10-dihydro-7H-tetracene-5,12-dione. CAS No. 62182-86-9. Pack Sizes: 1 mg. Product ID: BBF-03537. Molecular formula: C26H29NO10. Mole weight: 515.5. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydrocucurbitacin F Cucurbitacin IIb (CuIIb) is one of the major active compounds in Hemsleyadine tablets which have been used for clinical treatment of bacillary dysentery, enteritis and acute tonsilitis. Group: Pharmaceutical. Alternative Names: Cucurbitacin Iib; 23,24-Dihydrocucurbitacin F. CAS No. 50298-90-3. Pack Sizes: 25 mg. Product ID: NP7023. Molecular formula: C30H48O7. Mole weight: 520.7. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydrocyclosporin A An impurity of Cyclosporine. Cyclosporine is a powerful immunosuppressive medication derived from a fungal source. It is primarily used to prevent organ rejection in transplant recipients by inhibiting the activation of T-cells, a key component of the immune system. Cyclosporine is also used to treat certain autoimmune diseases, such as psoriasis and rheumatoid arthritis, where the immune system mistakenly attacks the bodys own tissues. Group: Pharmaceutical. Alternative Names: Ciclosporin Impurity B; 1,11-Anhydro[L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)octanoyl-(2S)-2-aminobutanoyl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucine]; Dihydrociclosporin A; 6-[(2S,3R,4R)-3-Hydroxy-4-methyl-2-(methylamino)octanoic acid]cyclosporin A; 6-[(3R,4R)-3-Hydroxy-N,4-dimethyl-L-2-aminooctanoic acid]cyclosporin A; Dihydro Cyclosporin A; Dihydrocyclosporine A; Cyclosporin A Dihydro Impurity; Cyclosporine EP Impurity B; Ciclosporin EP Impurity B. CAS No. 59865-15-5. Pack Sizes: 25 mg. Product ID: BBF-05757. Molecular formula: C62H113N11O12. Mole weight: 1204.62. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydro Donepezil Dihydro Donepezil is an impurity of Donepezil, a medication for the treatment of Alzheimer's disease. Group: Pharmaceutical. Alternative Names: 2-(1-Benzyl-piperidin-4-ylmethyl)-5,6-dimethoxy-indan-1-ol; Donepezil Impurity-VI. CAS No. 120012-04-6. Pack Sizes: 100 mg. Product ID: B0794-470371. Molecular formula: C24H31NO3. Mole weight: 381.516. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydroethidium Dihydroethidium is a cell-permeable blue fluorescent dye, which intercalates with nucleic acids and emits a red fluorescence detectable qualitatively by fluorescent microscopy or quantitatively by HPLC. It is a superoxide indicator. It exhibits blue fluorescence in the cytosol until oxidizedto ethidium, where it intercalates within the cell's DNA, staining its nucleus a bright fluorescent red. It is neuroprotective by reducing superoxide in mice after stroke. It has been used to detect reactive oxygen species during the phagocytic respiratory burst and for the detection of intracellular superoxide in cultured cells. Group: Pharmaceutical. Alternative Names: Hydroethidine; PD-MY 003; 5-ethyl-5,6-dihydro-6-phenyl-3,8-phenanthridinediamine; 5-Ethyl-6-phenyl-6H-phenanthridine-3,8-diamine. CAS No. 104821-25-2. Pack Sizes: 500 mg. Product ID: B2706-081229. Molecular formula: C21H21N3. Mole weight: 315.4. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydromevinolin Dihydromevinolin is an impurity in Lovastatin bulk drug. It is produced by the strain of Aspergollus terreus. Group: Pharmaceutical. Alternative Names: 4a,5-Dihydro Lovastatin; (2S)-2-Methylbutanoic Acid (1S,3S,4aR,7S,8S,8aS)-1,2,3,4,4a,7,8,8a-Octahydro- 3,7-dimethyl-8-[2-[(2R,4R)-tetrahydro-4-hydroxy-6-oxo-2H-pyran-2-yl]ethyl]-1-naphthalenyl Ester; (+)-Dihydromevinolin; Dihydrolovastatin; Dihydromevinol. CAS No. 77517-29-4. Pack Sizes: 1mg;1g;10g. Product ID: BBF-01842. Molecular formula: C24H38O5. Mole weight: 406.56. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydromorin Dihydromorin is a flavonoid isolated from the branch of Morus alba L. Group: Pharmaceutical. Alternative Names: 2',3,4',5,7-pentahydroxyflavanone; (2R,3R)-2-(2,4-Dihydroxyphenyl)-3,5,7-trihydroxychroMan-4-one. CAS No. 18422-83-8. Pack Sizes: 5 mg. Product ID: NP2116. Molecular formula: C15H12O7. Mole weight: 304.25. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydromyrcenate Dihydromyrcenate. Industry Served: Fragrances Suppliers Wanted
England
Dihydromyrcenol Dihydromyrcenol. CAS No. 18479-58-8. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Dihydromyrcenol / Tetrahydromyrcenol Dihydromyrcenol / Tetrahydromyrcenol. Industry Served: Fragrances Suppliers Wanted
England
Dihydromyricetin Ampelopsin is a flavanonol isolated from the herb of Myrica rubra (Lour.)Zucc., exhibiting antioxidant, antiproliferative, anti-apoptotic, and anti-alcohol intoxication properties. Ampelopsin is a natural compound used in cosmetics material. It can improve the skin barrier and has multiple effects such as anti-aging and removing wrinkles, whitening and lightening spots, soothing repair, anti-inflammatory, and antibacterial. In addition, it has the effect of healing wounds and nursing hair. Uses: Food, health care products. Group: Pharmaceutical. Alternative Names: Ampelopsis Grossedentata Extract; Water-Soluble Dihydromyricetin; (2R,3R)-2,3-Dihydro-3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-4H-1-benzopyran-4-one; 4H-1-Benzopyran-4-one, 2,3-dihydro-3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-, (2R-trans)-; Ampelopsin; Flavanone, 3,3',4',5,5',7-hexahydroxy-; (+)-Ampelopsin; (+)-Dihydromyricetin; Ampelopsin (flavanol); Ampeloptin; REL-Eqyms 98. CAS No. 27200-12-0. Pack Sizes: 1 g. Product ID: NP1829. Molecular formula: C15H12O8. Mole weight: 320.25. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydrooxoepistephamiersine Dihydrooxoepistephamiersine is a natural alkaloid found in the root of Stephania japonica. Group: Pharmaceutical. Alternative Names: (6β,7β,8β,10β)-6-Hydroxy-3,4,7,8-tetramethoxy-17-methyl-8,10-epox yhasubanan-16-one. CAS No. 51804-69-4. Pack Sizes: 1 mg. Product ID: NP0384. Molecular formula: C21H27NO7. Mole weight: 405.5. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydropalmatine Dihydropalmatine is an alkaloid isolated from the the roots and stem barks of Berberis aristata. Group: Pharmaceutical. Alternative Names: 2,3,9,10-tetramethoxy-6,8-dihydro-5H-isoquinolino[2,1-b]isoquinoline. CAS No. 26067-60-7. Pack Sizes: 10 mg. Product ID: B2703-186436. Molecular formula: C21H23NO4. Mole weight: 353.41. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydropinosylvin Dihydropinosylvin is a natural compound isolated from the herbs of Dioscorea rotundata. Group: Pharmaceutical. Alternative Names: 5-phenethylbenzene-1,3-diol; 3,5-Dihydroxybibenzyl. CAS No. 14531-52-3. Pack Sizes: 500 mg. Product ID: NP4623. Molecular formula: C14H14O2. Mole weight: 214.3. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydropyrenophorin Dihydropyrenophorin is a macrolide produced by Drechslera avenae. It is the pathogen of oat leaf spot. Dihydropyrenophorin has antifungal activity. Group: Pharmaceutical. Alternative Names: 13S-hydroxy-8R,16R-dimethyl-1,9-dioxacyclohexadeca-3E,11E-diene-2,5,10-trione. CAS No. 1073287-13-4. Pack Sizes: 1mg;1g;10g. Product ID: BBF-04890. Molecular formula: C16H22O6. Mole weight: 310.34. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydroresveratrol 3-O-glucoside Dihydroresveratrol 3-O-glucoside is isolated from the rhizomes of Polygonum cuspidatum Sieb. et Zucc. Group: Pharmaceutical. Alternative Names: 3-Hydroxy-5-[2-(4-hydroxyphenyl)ethyl]phenyl β-D-glucopyranoside. CAS No. 100432-87-9. Pack Sizes: 1 mg. Product ID: NP4615. Molecular formula: C20H24O8. Mole weight: 392.4. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydrosanguinarine Dihydrosanguinarine (DHSG) is a metabolite of Sanguinarine with antifungal activity. Group: Pharmaceutical. Alternative Names: 13,14-Dihydrosanguinarine. CAS No. 3606-45-9. Pack Sizes: 25 mg. Product ID: B1370-112370. Molecular formula: C20H15NO4. Mole weight: 333.34. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydrostreptomycin sesquisulfate 25g Pack Size. Group: Antibiotics, Bioactive Small Molecules. Formula: C21H41N7O12 ·1.5H2SO4. CAS No. 5490-27-7. Prepack ID : 12129709-25g. Molecular Weight : 730.71. Molekula
Dihydro Tofacitinib Citrate An impurity of Tofacitinib, which is a Janus kinase inhibitor and could be used against rheumatoid arthritis. Group: Pharmaceutical. Alternative Names: Tofacitinib Impurity; 5,6-Dihydro CP-690550 citrate; 5,6-Dihydro Tofacitinib citrate. Pack Sizes: 25 mg. Product ID: B2694-342495. Molecular formula: C22H30N6O8. Mole weight: 506.51. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Dihydroxyacetone Dihydroxyacetone. CAS No. 96-26-4. Product ID: C-58787. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Diindolylmethane 100g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C17H14N2. CAS No. 1968-5-4. Prepack ID : 12202174-100g. Molecular Weight : 246.31. Molekula
Diindolylmethane 25g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C17H14N2. CAS No. 1968-5-4. Prepack ID : 12202174-25g. Molecular Weight : 246.31. Molekula
Diiodomethane Diiodomethane Uses: Pharmaceutical R&D. Group: Iodides. CAS No. 75-11-6. Pack Sizes: Enquire for MOQ. Categories: NORDMANN Key intermediates and specialty chemicals suppliers. Nordmann UK Fine Chemicals
UK / EU / USA / Japan
Diiodomethane Diiodomethane. CAS No. 75-11-6. Product ID: C-58598. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
di-I-propylchlorophosphine di-I-propylchlorophosphine. CAS No. 40244-90-4. Product ID: C-52397. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Diisobutoxy-bisethylacetoacetatotitanate Diisobutoxy-bisethylacetoacetatotitanate - TYZOR IBAY. Group: Metal alkoxides. CAS No. 83877-91-2. Pack Sizes: 1kg; 5kg; 25kg; 100kg; 200kgs. Product ID: AB127613. Categories: Coatings and as catalysts; harmol hydrochloride. ABCR (UK)
Diisobutylaluminum hydride Diisobutylaluminum hydride. CAS No. 1191-15-7. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
diisobutyl succinate diisobutyl succinate (CAS# 925-06-4 ) is a useful research chemical. Group: Pharmaceutical. Alternative Names: Butanedioic acid diisobutyl ester; Butanedioic acid, bis(2-methylpropyl) ester; Succinic acid diisobutyl ester. CAS No. 925-06-4. Pack Sizes: 1 g. Product ID: B2699-079627. Molecular formula: C12H22O4. Mole weight: 230.3. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Diisodecyl Phthalate 500g Pack Size. Group: Analytical Reagents, Building Blocks, Organics. Formula: C28H46O4. CAS No. 26761-40-0. Prepack ID : 59649458-500g. Molecular Weight : 446.66. Molekula
DIISOOCTYL SEBACATE (BIS(2-ETHYLHEXYL) SEBACATE) DIISOOCTYL SEBACATE (BIS(2-ETHYLHEXYL) SEBACATE). Uses: Cosmetic and industrial use. Alternative Names: Diisooctyl Sebacate. CAS No. 122-62-3. Categories: Dioctyl sebacate. East Harbour Group
di-Isopropanolamine di-Isopropanolamine. CAS No. 110-97-4. Product ID: C-58597. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
DIISOPROPANOLAMINE (DIPA85%) DIISOPROPANOLAMINE (DIPA85%). At Tan International we supply a wide range of products covering all industry sectors Tan International
Scotland
Diisopropanolnitrosamine Diisopropanolnitrosamine, a prevalent mutagenic and carcinogenic chemical found in the pharmaceutical and scientific research industry, is known to cause various forms of cancers, notably liver and lung cancer. Research evidence indicates its exposure can lead to increased rates of DNA mutations and cell death. Uses: It shows carcinogenicity in the duct cells. Group: Pharmaceutical. Alternative Names: N-Nitroso-bis(2-hydroxypropyl)amine; 1,1'-(Nitrosoimino)bis[2-propanol]; 2,2'-Dihydroxydipropylnitrosamine; DHPN; Di(2-hydroxypropyl)nitrosamine; N-Bis(2-hydroxypropyl)nitrosamine; N-Nitrosobis(2-hydroxypropyl)amine; N-Nitrosodiisopropanolamine; Nitrosobis(2-hydroxypropyl)amine. CAS No. 53609-64-6. Pack Sizes: 500 mg. Product ID: B2699-123096. Molecular formula: C6H14N2O3. Mole weight: 162.19. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London
Diisopropyl adipate Diisopropyl adipate. CAS No. 6938-94-9. Product ID: C-34316. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Diisopropylamine Diisopropylamine. CAS No. 108-18-9 . Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications. Cenik Chemicals
Cenik Chemicals
Diisopropylamine 500ml Pack Size. Group: Amines, Building Blocks, Organics. Formula: C6H15N. CAS No. 108-18-9. Prepack ID : 45926137-500ml. Molecular Weight : 101.19. Molekula
Diisopropylamine Diisopropylamine. CAS No. 108-18-9. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications. Cenik Chemicals
Cenik Chemicals
Diisopropylammonium tetrazolide Diisopropylammonium tetrazolide is a biochemical for proteomics research. Group: Pharmaceutical. Alternative Names: Diisoropyl Ammonium Tetrazolide; 1H-1,2,3,4-tetrazole; bis(propan-2-yl)amine. CAS No. 93183-36-9. Pack Sizes: 100 g. Product ID: B1370-459000. Molecular formula: C7H17N5. Mole weight: 171.25. Custom synthesis is available. Send your inquiries for more information. Categories: Diisopropylammoniumtetrazolide. BOC Sciences
London
Diisopropylammonium tetrazolide 5g Pack Size. Group: Building Blocks, Organics. Formula: C7 H17N5. CAS No. 93183-36-9. Prepack ID : 90004741-5g. Molecular Weight : 171.24. Molekula
Diisopropyl azodicarboxylate Diisopropyl azodicarboxylate. CAS No. 2446-83-5. Product ID: C-34319. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK
Diisopropyl azodicarboxylate Diisopropyl azodicarboxylate. CAS No. 2446-83-5. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications. Cenik Chemicals
Cenik Chemicals
Diisopropyl azodicarboxylate 100g Pack Size. Group: Building Blocks, Organics. Formula: C8H14N2O4. CAS No. 2446-83-5. Prepack ID : 60185677-100g. Molecular Weight : 202.21. Molekula
Diisopropyl(bromomethyl)boronate Diisopropyl(bromomethyl)boronate. CAS No. 137297-49-5. Product ID: C-12470. CARBONE SCIENTIFIC CO
CARBONE SCIENTIFIC UK