A directory of where to buy chemicals in the UK including: distributors, industrial manufacturers, wholesalers, raw ingredients, bulk supplies and finished goods for sale.
Search for products or services, then visit the suppliers website for prices, SDS or more information.
| Product | Description | |
|---|---|---|
| Diethyl Benzene | Diethyl Benzene, CAS 25340-17-4, Performance Chemicals. Formerly Lansdowne Chemicals | OQEMA England, Oxfordshire |
| Diethyl bis(hydroxymethyl)malonate | Diethyl bis(hydroxymethyl)malonate, a chemical compound found in the pharmaceutical industry, has been found to have potential uses in the treatment of Alzheimer's disease and cancer due to its unique properties. Additionally, it plays a significant role in the synthesis of antiviral drugs, including acyclovir and ganciclovir. Its prominence in drug production highlights its importance in the medical field. Group: Pharmaceutical. Alternative Names: Diethyl 2,2-bis(hydroxymethyl)malonate; Propanedioic acid, bis(hydroxymethyl)-, diethyl ester. CAS No. 20605-01-0. Pack Sizes: 500 g. Product ID: B2699-010716. Molecular formula: C9H16O6. Mole weight: 220.22. Custom synthesis is available. Send your inquiries for more information. |  London |
| Diethyl carbonate | 100g Pack Size. Group: Building Blocks, Organics. Formula: C5H10O3. CAS No. 105-58-8. Prepack ID : 89966665-100g. Molecular Weight : 118.13. |  |
| Diethyl cyanomethylphosphonate | 100g Pack Size. Group: Building Blocks, Organics, Reagents. Formula: C6H12NO3P. CAS No. 2537-48-6. Prepack ID : 64731379-100g. Molecular Weight : 177.14. | |
| Diethyl-D-tartrate | 25g Pack Size. Group: Building Blocks, Chiral Compounds, Organics. Formula: C8H14O6. CAS No. 13811-71-7. Prepack ID : 19167747-25g. Molecular Weight : 206.19. | |
| Diethylene Glycol | Diethylene Glycol. Uses: Pharmaceuticals, Personal Care, Industrial. Grades: Pharma, Cosmetic, Food, Feed, Technical. CAS No. 111-46-6. Pack Sizes: Bulk. Cenik is your partner of choice for Hard-to-find chemicals. We don't just provide products, we supply solutions to your technical and regulatory specifications. |  Cenik Chemicals |
| Di Ethylene Glycol (DEG) | Di Ethylene Glycol (DEG). At Tan International we supply a wide range of products covering all industry sectors |  Scotland |
| Diethylene glycol diethyl ether reagent grade, ¥98% | 500g Pack Size. Group: Analytical Reagents, Diagnostic Raw Materials, Solvents. Formula: C8H18O3. CAS No. 112-36-7. Prepack ID : 89967227-500g. Molecular Weight : 162.23. | |
| Diethylene glycol methyl ethyl ether | Diethylene glycol methyl ethyl ether. Uses: Pharmaceuticals, Personal Care, Industrial. Grades: Pharma, Cosmetic, Food, Feed, Technical. CAS No. 1002-67-1. Pack Sizes: Bulk. Cenik is your partner of choice for Hard-to-find chemicals. We don't just provide products, we supply solutions to your technical and regulatory specifications. Categories: 1-ethoxy-2-(2-methoxyethoxy)ethane. | Cenik Chemicals |
| Diethylene glycol monobutyl ether | 1kg Pack Size. Group: Building Blocks, Organics. Formula: C8H18O3. CAS No. 112-34-5. Prepack ID : 21823572-1kg. Molecular Weight : 162.23. | |
| Diethyleneglycol monobutyl ether | Diethyleneglycol monobutyl ether. Uses: Pharmaceuticals, Personal Care, Industrial. Grades: Pharma, Cosmetic, Food, Feed, Technical. CAS No. 112-34-5. Pack Sizes: Bulk. Cenik is your partner of choice for Hard-to-find chemicals. We don't just provide products, we supply solutions to your technical and regulatory specifications. Categories: 2-(2-butoxyethoxy)ethanol. | Cenik Chemicals |
| Diethylene glycol mono-methacrylate | Diethylene glycol mono-methacrylate has been utilized in the fabrication of pharmaceutical carriers designed for the regulated dissemination of pharmacological agents, notably for the management of enduring medical conditions like cancer. Group: Pharmaceutical. Alternative Names: 2-Propenoic acid, 2-methyl-, 2-(2-hydroxyethoxy)ethyl ester; PEG-2 methacrylate. CAS No. 2351-43-1. Pack Sizes: 500 mg. Product ID: B1370-007519. Molecular formula: C8H14O4. Mole weight: 174.19. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethylene glycol monomethyl ether | 100g Pack Size. Group: Analytical Reagents, Diagnostic Raw Materials, Solvents. Formula: C5H12O3. CAS No. 111-77-3. Prepack ID : 89967164-100g. Molecular Weight : 120.15. | |
| Diethylene glycol monomethyl ether | 500g Pack Size. Group: Analytical Reagents, Diagnostic Raw Materials, Solvents. Formula: C5H12O3. CAS No. 111-77-3. Prepack ID : 89967164-500g. Molecular Weight : 120.15. | |
| Diethylenetriamine pentaacetic acid | 1kg Pack Size. Group: Building Blocks, Ligands. Formula: C14H23N3O10. CAS No. 67-43-6. Prepack ID : 69522692-1kg. Molecular Weight : 393.35. | |
| Diethylethanolamine Dicyclohexylketone | Diethylethanolamine Dicyclohexylketone is an impurity of Dicyclomine, which is an M1 and M2 muscarinic acetylcholine receptor antagonist. Group: Pharmaceutical. CAS No. 2731926-17-1. Pack Sizes: 100 mg. Product ID: B1370-286446. Molecular formula: C19H35NO2. Mole weight: 309.49. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl ether | 100ml Pack Size. Group: Building Blocks, Organics, Solvents. Formula: (CH3CH2)2O. CAS No. 60-29-7. Prepack ID : 25426302-100ml. Molecular Weight : 74.12. | |
| DIETHYL ETHER AR | DIETHYL ETHER AR, UK suppliers of laboratory chemicals and apparatus needed |  |
| DIETHYL ETHER (TECHNICAL GRADE) | Is a organic compound in the ether class with the formula (C2H5)2O, sometimes abbreviated as Et2O. It is a colourless, highly volatile, sweet-smelling ("ethereal odour"), extremely flammable liquid. Uses: Laboratory chemicals, Industrial & for professional use. Alternative Names: Ether. CAS No. 60-29-7. |  |
| Diethyl ethoxy methyl enemalonate | 100g Pack Size. Group: Building Blocks, Organics. Formula: C10H16O5. CAS No. 87-13-8. Prepack ID : 16946616-100g. Molecular Weight : 216.23. | |
| Diethyl isocyano methyl phosphonate, 97% | 1g Pack Size. Group: Building Blocks, Organics. Formula: C6H12NO3P. CAS No. 41003-94-5. Prepack ID : 90027205-1g. Molecular Weight : 177.14 g/mol. | |
| Diethyl malonate | Diethyl malonate. Uses: Pharmaceuticals, Personal Care, Industrial. Grades: Pharma, Cosmetic, Food, Feed, Technical. CAS No. 105-53-3. Pack Sizes: Bulk. Cenik is your partner of choice for Hard-to-find chemicals. We don't just provide products, we supply solutions to your technical and regulatory specifications. Categories: diethyl propanedioate. | Cenik Chemicals |
| Diethyl Malonate | Diethyl Malonate. At Tan International we supply a wide range of products covering all industry sectors | Scotland |
| Diethyl Malonate | Diethyl Malonate Uses: Pharmaceutical R&D. Group: Intermediates. CAS No. 105-53-3. Pack Sizes: 200kg Drums. Categories: NORDMANN UK Fine Chemicals Suppliers. |  UK / EU / USA / Japan |
| Diethyl Malonate | Diethyl Malonate, CAS 105-53-3, Performance Chemicals. Formerly Lansdowne Chemicals | OQEMA England, Oxfordshire |
| Diethyl malonate-[1,2,3-13C3] | Diethyl malonate-[1,2,3-13C3] is a labelled compound of Diethyl Malonate. Acylation of diethyl malonate using magnesium chloride and triethylamine is reported. Group: Pharmaceutical. Alternative Names: 13C Labeled diethyl malonate; 13C Labeled diethyl malonic acid; Malonic acid diethyl ester-13C3. CAS No. 53051-81-3. Pack Sizes: 1 g. Product ID: BLP-011108. Molecular formula: C4[13C]3H12O4. Mole weight: 163.15. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethylmethyl(2-methoxyethyl)ammonium bis(trifluoromethylsulfonyl)imide | Diethylmethyl(2-methoxyethyl)ammonium bis(trifluoromethylsulfonyl)imide. Group: Pharmaceutical. Alternative Names: N,N-Diethyl-N-methyl-N-(2-methoxyethyl)ammonium bis(trifluoromethanesulfonyl)imide. CAS No. 464927-84-2. Pack Sizes: 5 g. Product ID: B2699-189240. Molecular formula: C10H20F6N2O5S2. Mole weight: 426.4. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl oxalate | 1kg Pack Size. Group: Building Blocks, Organics. Formula: C6H10O4. CAS No. 95-92-1. Prepack ID : 31156858-1kg. Molecular Weight : 146.14. | |
| Diethyl ((phenylsulfonyl)methyl)phosphonate | Diethyl ((phenylsulfonyl)methyl)phosphonate. Uses: Pharmaceuticals, Personal Care, Industrial. Grades: Pharma, Cosmetic, Food, Feed, Technical. CAS No. 56069-39-7. Pack Sizes: Bulk. Cenik is your partner of choice for Hard-to-find chemicals. We don't just provide products, we supply solutions to your technical and regulatory specifications. Categories: 56 diethyl (phenylsulfonyl)methanephosphonate. | Cenik Chemicals |
| Diethylphosphinic acid | Diethylphosphinic acid, a versatile compound, is a pivotal component in organic synthesis. Owing to its remarkable capability to act as a ligand in metal-catalyzed reactions, it accentuates molecular designing. Its scope has been broadened to pharmaceuticals too, where it is researched for its prospective utilization as a pain therapy and to eradicate inflammation among patients featuring neuropathic ailments. Group: Pharmaceutical. Alternative Names: diethyl-phosphinic acid; Phosphinic acid, P,P-diethyl-. CAS No. 813-76-3. Pack Sizes: 100 mg. Product ID: B0001-084500. Molecular formula: C4H11O2P. Mole weight: 122.1. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl phosphite | 500g Pack Size. Group: Building Blocks, Organics. Formula: C4H11O3P. CAS No. 762-04-9. Prepack ID : 40923677-500g. Molecular Weight : 138.1. | |
| Diethyl phthalate | 500g Pack Size. Group: Building Blocks, Organics. Formula: C6H4-1,2-(CO2C2H5)2. CAS No. 84-66-2. Prepack ID : 31953402-500g. Molecular Weight : 222.24. | |
| DIETHYL PHTHALATE | Is a phthalate ester. It occurs as a colourless liquid without significant odour but has a bitter, disagreeable taste. It is more dense than water and insoluble in water; hence, it sinks in water. Uses: Laboratory chemicals, manufacture of substances. Alternative Names: DEP. CAS No. 84-66-2. | |
| Diethyl pimelate | 25g Pack Size. Group: Building Blocks, Organics. Formula: C11H20O4. CAS No. 2050-20-6. Prepack ID : 25808608-25g. Molecular Weight : 216.27. | |
| Diethyl propylmalonate | Diethyl propylmalonate Uses: Pharmaceutical Research and Development. Group: Intermediates. CAS No. 2163-48-6. Pack Sizes: Enquire for MOQ. Categories: Nordmann UK Fine Chemicals suppliers (Formerly Melrob-Eurolabs). | UK / EU / USA / Japan |
| Diethyl pyrocarbonate (DEPC) | 100g Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: C6H10O5. CAS No. 1609-47-8. Prepack ID : 22057917-100g. Molecular Weight : 162.14. | |
| Diethyl pyrocarbonate (DEPC) | 25g Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: C6H10O5. CAS No. 1609-47-8. Prepack ID : 22057917-25g. Molecular Weight : 162.14. | |
| Diethyl Succinate | Diethyl Succinate Uses: Pharmaceutical Research and Development. Group: Special Anhydrides. CAS No. 123-25-1. Pack Sizes: 220kg drums & IBC's. Categories: NORDMANN Key intermediates and specialty chemicals. | UK / EU / USA / Japan |
| Diethyl Sulfate | Diethyl Sulfate, CAS 64-67-5, Performance Chemicals. Formerly Lansdowne Chemicals | OQEMA England, Oxfordshire |
| Diethyl sulfone | 1g Pack Size. Group: Building Blocks, Organics. Formula: C4H10O2S. CAS No. 597-35-3. Prepack ID : 16682226-1g. Molecular Weight : 122.19. | |
| Diethyl sulfone | 100mg Pack Size. Group: Building Blocks, Organics. Formula: C4H10O2S. CAS No. 597-35-3. Prepack ID : 16682226-100mg. Molecular Weight : 122.19. | |
| Diethyl Sulphate, 99% Ps | 100g Pack Size. Group: Building Blocks, Organics. Formula: C4H10O4S. CAS No. 64-67-5. Prepack ID : 65617544-100g. Molecular Weight : 154.18. | |
| Diethyl Tenofovir | One impurity of Tenofovir, which is an acyclic phosphonate nucleotide derivative, could be used in antiviral treatment as an everse transcriptase inhibitor. Group: Pharmaceutical. Alternative Names: (R)-9-[2-(Diethylphosphonomethoxy)propyl] Adenine; P-[[(1R)-2-(6-Amino-9H-purin-9-yl)-1-methylethoxy]methyl]phosphonic Acid Diethyl Ester; [[(1R)-2-(6-Amino-9H-purin-9-yl)-1-methylethoxy]methyl]phosphonic Acid Diethyl Ester. CAS No. 180587-75-1. Pack Sizes: 100 mg. Product ID: B1707-234697. Molecular formula: C13H22N5O4P. Mole weight: 343.33. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyltoluamide | Diethyltoluamide is the most common active ingredient in many insect repellent products. Diethyltoluamide is also an effective solvent and may dissolve plastics, rayon, spandex, other synthetic fabrics and painted or varnished surfaces. Group: Pharmaceutical. Alternative Names: DEET; N,N-Diethyl-m-toluamide; 3-Methyl-N,N-diethylbenzamide; Metadelphene; Delphene; Flypel. CAS No. 134-62-3. Pack Sizes: 1mg;1g;10g. Product ID: 134-62-3. Molecular formula: C12H17NO. Mole weight: 191.27. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl Toluenediamine | Diethyl Toluenediamine (DETDA). CAS No. 68479-98-1. Gantrade Suppliers of a broad range of Monomers, Intermediates & Polymers. Categories: Diethyl toluene diamine. |  Worldwide |
| Difelikefalin | Difelikefalin is an analgesic opioid peptide acting as a peripherally specific, highly selective agonist of the κ-opioid receptor (KOR). It acts as an analgesic by activating KORs on peripheral nerve terminals and KORs expressed by certain immune system cells. It may be useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. It is under development by Cara Therapeutics as an intravenous agent for the treatment of postoperative pain. It lacks the central side effects due to its peripheral selectivity. It is also being investigated for the treatment of pruritus (itching). It has completed phase II clinical trials for postoperative pain and has demonstrated significant and "robust" clinical efficacy, along with being safe and well-tolerated. It is also in phase II clinical trials for uremic pruritus in hemodialysis patients. Uses: Difelikefalin may be useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. it is used as an intravenous agent for the treatment of postoperative pain. it is also being investigated for the treatment of pruritus (itching). Group: Pharmaceutical. Alternative Names: N1-(D-Phenylalanyl-D-phenylalanyl-D-leucyl-D-lysyl)-4-amino-4-piperidinecarboxylic acid; CR 845; D-Phe-D-Phe-D-Leu-D-Lys-[gamma-(4-N-piperidinyl)amino carboxylic acid]; 1-(D-Phenylalanyl-D-phenylalanyl-D-leucy | London |
| Difenamizole | Difenamizole is a non-steroidal anti-inflammatory drug (NSAID) and analgesic of the pyrazolone group related to metamizole. Group: Pharmaceutical. Alternative Names: 2-(dimethylamino)-N-(2,5-diphenylpyrazol-3-yl)propanamide; Difenamizole; Difenamizole [INN]; Difenamizolum; BRN 0698538; Diphenamizole; Pasalin; UNII-24MR6YLL3W; BRN-0698538; BRN0698538. CAS No. 20170-20-1. Pack Sizes: 1mg;1g;10g. Product ID: 20170-20-1. Molecular formula: C20H22N4O. Mole weight: 334.415. Custom synthesis is available. Send your inquiries for more information. | London |
| Difethialone | Difethialone is an anticoagulant used as an rodenticide. Group: Pharmaceutical. Alternative Names: 3-[3-[4-(4-bromophenyl)phenyl]-1,2,3,4-tetrahydronaphthalen-1-yl]-2-hydroxythiochromen-4-one. CAS No. 104653-34-1. Pack Sizes: 1mg;1g;10g. Product ID: 104653-34-1. Molecular formula: C31H23BrO2S. Mole weight: 539.487. Custom synthesis is available. Send your inquiries for more information. | London |
| Difloxacin-[d3] Hydrochloride | Difloxacin-[d3] Hydrochloride is a labelled Difloxacin hydrochloride, which is a fluoroquinolone antibiotic commonly used in veterinary medicine. Group: Pharmaceutical. Alternative Names: Difloxacin D3 Hydrochloride. CAS No. 1173021-89-0. Pack Sizes: 10 mg. Product ID: BLP-012314. Molecular formula: C21H17D3ClF2N3O3. Mole weight: 438.87. Custom synthesis is available. Send your inquiries for more information. | London |
| Difloxacin Hydrochloride | A fluoroquinolone antibiotic commonly used in veterinary medicine. It is an inhibitor of Topo II. Group: Pharmaceutical. Alternative Names: 6-Fluoro-1-(4-fluorophenyl)-1,4-dihydro-7-(4-methylpiperazino)-4-oxo-3-quinolinecarboxylic acid hydrochloride; Difloxacin HCl. CAS No. 91296-86-5. Pack Sizes: 1mg;1g;10g. Product ID: BBF-04642. Molecular formula: C21H19F2N3O3.HCl. Mole weight: 435.85. Custom synthesis is available. Send your inquiries for more information. | London |
| Diflubenzuron | Diflubenzuron is a benzoylurea-type insecticide of the benzamide class. The mechanism of action of diflubenzuron involves inhibiting the production of chitin which is used by an insect to build its exoskeleton. Group: Pharmaceutical. Alternative Names: Difluron; Dimilin; Larvakil; N-[(4-chlorophenyl)carbamoyl]-2,6-difluorobenzamide. CAS No. 35367-38-5. Pack Sizes: 1mg;1g;10g. Product ID: 35367-38-5. Molecular formula: C14H9ClF2N2O2. Mole weight: 310.685. Custom synthesis is available. Send your inquiries for more information. | London |
| Diflubenzuron (1-(4-chloro-phenyl)-3-(2,6-difluorobenzoyl) urea) | 1g Pack Size. Group: Analytical Reagents, Building Blocks. Formula: C14H9ClF2N2O2. CAS No. 35367-38-5. Prepack ID : 12617635-1g. Molecular Weight : 310.68. | |
| Difluoromethanesulfonyl chloride | Difluoromethanesulfonyl chloride. Uses: Pharmaceuticals, Personal Care, Industrial. Grades: Pharma, Cosmetic, Food, Feed, Technical. CAS No. 1512-30-7. Pack Sizes: Bulk. Cenik is your partner of choice for Hard-to-find chemicals. We don't just provide products, we supply solutions to your technical and regulatory specifications. Categories: 1 difluoromethanesulphonyl chloride. | Cenik Chemicals |
| Difluoromethyl difluoromethanesulfonate | Difluoromethyl difluoromethanesulfonate. Uses: Pharmaceuticals, Personal Care, Industrial. Grades: Pharma, Cosmetic, Food, Feed, Technical. CAS No. 101817-80-5. Pack Sizes: Bulk. Cenik is your partner of choice for Hard-to-find chemicals. We don't just provide products, we supply solutions to your technical and regulatory specifications. Categories: 101 schembl12345777. | Cenik Chemicals |
| Difluprednate | 1g Pack Size. Group: Bioactive Small Molecules, Biochemicals, Research Organics & Inorganics. Formula: C27H34F2O7. CAS No. 23674-86-4. Prepack ID : 47585639-1g. Molecular Weight : 508.55. | |
| Difopein | Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Group: Pharmaceutical. Alternative Names: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG. CAS No. 396834-58-5. Pack Sizes: 1 mg. Product ID: BAT-010334. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17. Custom synthesis is available. Send your inquiries for more information. | London |
| DIGITAL STOPWATCH, 12mm | DIGITAL STOPWATCH, 12mm, UK suppliers of laboratory chemicals wanted | |
| DIGITAL STOPWATCH, 24hr | DIGITAL STOPWATCH, 24hr, UK suppliers of laboratory chemicals and apparatus needed | |
| Digitonin | 1g Pack Size. Group: Biochemicals, Research Organics & Inorganics. Formula: C56H92O29. CAS No. 11024-24-1. Prepack ID : 84387497-1g. Molecular Weight : 1229.31. | |
| Digitoxin | 1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C41H64O13. CAS No. 71-63-6. Prepack ID : 60859961-1g. Molecular Weight : 764.94. | |
| Diglycidyl Terephthalate | Diglycidyl Terephthalate (DGT) is a monomeric compound utilized for producing high-thermal resistant polymers. As a cross-linking agent in polymerization reactions, DGT generates robust materials with exceptional stability and durability. Furthermore, its multifunctional properties make it ideal for developing composite materials, particularly in the aerospace and industrial sectors. The capability of DGT to enhance the overall performance of materials is significant, and its applications are diverse. Group: Pharmaceutical. Alternative Names: Bis(2,3-epoxypropyl) terephthalate; Terephthalic acid diglycidyl ester. CAS No. 7195-44-0. Pack Sizes: 500 mg. Product ID: B2699-315506. Molecular formula: C14H14O6. Mole weight: 278.26. Custom synthesis is available. Send your inquiries for more information. | London |
| Digoxin | 1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C41H64O14. CAS No. 20830-75-5. Prepack ID : 24736068-1g. Molecular Weight : 780.94. | |
| Dihydro-3-(tetrapropenyl)furan-2,5-dione | 100g Pack Size. Group: Building Blocks, Organics. Formula: C16H26O3. CAS No. 26544-38-7. Prepack ID : 89985628-100g. Molecular Weight : 266.38. | |
| Dihydroajugapitin | Dihydroajugapitin is a diterpenoid compound isolated from the herbs of Ajuga ciliata Bunge. Group: Pharmaceutical. Alternative Names: 14,15-Dihydroajugapitin; (1R,2S,3R,4aR,5S,6R,8S,8aR)-8-Acetoxy-8a-(acetoxymethyl)-5-[(2S,3aR,6aS)-hexahydrofuro[2,3-b]furan-2-yl]-3-hydroxy-5,6-dimethyloctahydro-2H-spiro[naphthalene-1,2'-oxiran]-2-yl (2S)-2-methylbutanoate. CAS No. 87480-84-0. Pack Sizes: 5 mg. Product ID: NP1672. Molecular formula: C29H44O10. Mole weight: 552.7. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydroalpinumisoflavone | Dihydroalpinumisoflavone is a flavonoid derivative isolated from the herbs of Erythrina arborescens. Uses: Antibacterial. Group: Pharmaceutical. Alternative Names: 5-Hydroxy-7-(4-hydroxyphenyl)-2,2-dimethyl-3,4-dihydro-2H,6H-pyrano[3,2-g]chromen-6-one. CAS No. 63807-90-9. Pack Sizes: 5 mg. Product ID: NP2447. Molecular formula: C20H18O5. Mole weight: 338.4. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydroartemisinin | Dihydroartemisinin is an anti-malarial agent. It is a metabolite of Artemisinin. Group: Pharmaceutical. Alternative Names: 3,12-Epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol, decahydro-3,6,9-trimethyl-, (3R,5aS,6R,8aS,9R,10S,12R,12aR)-; (3R,5aS,6R,8aS,9R,10S,12R,12aR)-Decahydro-3,6,9-trimethyl-3,12-epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol; 3,12-Epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol, decahydro-3,6,9-trimethyl-, [3R-(3α,5aβ,6β,8aβ,9α,10α,12β,12aR*)]-; Alaxin; Artemisinin deriv. DHA; Artenimol; CID 3000518; Cotecxin; Cotexin; DHA; DHQHS 2; Dihydroartemisinine; Dihydroqinghaosu; Dynamax; HC 101C; Salaxin; Santecxin; β-Dihydroartemisinin. CAS No. 71939-50-9. Pack Sizes: 1mg;1g;10g. Product ID: NP5947. Molecular formula: C15H24O5. Mole weight: 284.35. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydro-Axitinib | Dihydro-Axitinib is an impurity of Axitinib, a tyrosine kinase inhibitor used for the treatment of kidney cancer. Group: Pharmaceutical. CAS No. 1443118-73-7. Pack Sizes: 10 mg. Product ID: B1370-467094. Molecular formula: C22H20N4OS. Mole weight: 388.49. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydroberberine | Dihydroberberine, isolated from the tubers of Corydalis decumbens (Thunb.) Pers, was identified that displayed improved in vivo efficacy in terms of counteracting increased adiposity, tissue triglyceride accumulation, and insulin resistance in high-fat-fed rodents. It is also a potential therapeutic reagent for type 2 diabetes treatment. Uses: Anti-tumor. Group: Pharmaceutical. Alternative Names: 5,8-Dihydro-9,10-dimethoxy-6H-benzo[g]-1,3-benzodioxolo[5,6-a]quinolizine; 9,10-Dimethoxy-2,3-(methylenedioxy)-13,13a-didehydroberbine; Dihydroumbellatine; 9,10-DiMethoxy-6,8-dihydro-5H-[1,3]dioxolo[4,5-g]isoquinolino[3,2-a]isoquinoline; Dihydroumbellatine. CAS No. 483-15-8. Pack Sizes: 10 mg. Product ID: B2703-465605. Molecular formula: C20H19NO4. Mole weight: 337.36. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydro Capsaicin | Dihydro Capsaicin is a terpene alkaloid found in Capsicum. Uses: Sterilization. Group: Pharmaceutical. Alternative Names: Dihydrocapsaicin; 6,7-Dihydrocapsaicin; N-(4-hydroxy-3-methoxybenzyl)-8-methylnonanamide; 8-Methyl-N-vanillylnonanamide. CAS No. 19408-84-5. Pack Sizes: 250 mg. Product ID: B2703-465114. Molecular formula: C18H29NO3. Mole weight: 307.43. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydrocarminomycin | Dihydrocarminomycin is an anthracycline antibiotic that can be produced by Streptomyces atroviolaceus DS 8938, Str. coeruleorubidus DS 8899, DS 31723, DS 7126 and Str. bifurcus DS 23219. Group: Pharmaceutical. Alternative Names: Carminomycinol; Antibiotic 32999RP; RP-32999; RP 32999; RP32999; (9S)-7-(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy-4,6,9,11-tetrahydroxy-9-(1-hydroxyethyl)-8,10-dihydro-7H-tetracene-5,12-dione. CAS No. 62182-86-9. Pack Sizes: 1 mg. Product ID: BBF-03537. Molecular formula: C26H29NO10. Mole weight: 515.5. Custom synthesis is available. Send your inquiries for more information. | London |
