A directory of where to buy chemicals in the UK including: distributors, industrial manufacturers, wholesalers, raw ingredients, bulk supplies and finished goods for sale.
5g Pack Size. Group: Fluorinated Products, Research Organics & Inorganics. Formula: (C2H5)2NSF3. CAS No. 38078-09-0. Prepack ID : 15439535-5g. Molecular Weight : 161.19.
Diethylaminosulfur trifluoride (DAST)
25g Pack Size. Group: Fluorinated Products, Research Organics & Inorganics. Formula: (C2H5)2NSF3. CAS No. 38078-09-0. Prepack ID : 15439535-25g. Molecular Weight : 161.19.
Diethyl bis(hydroxymethyl)malonate
Diethyl bis(hydroxymethyl)malonate, a chemical compound found in the pharmaceutical industry, has been found to have potential uses in the treatment of Alzheimer's disease and cancer due to its unique properties. Additionally, it plays a significant role in the synthesis of antiviral drugs, including acyclovir and ganciclovir. Its prominence in drug production highlights its importance in the medical field. Group: Pharmaceutical. Alternative Names: Diethyl 2,2-bis(hydroxymethyl)malonate; Propanedioic acid, bis(hydroxymethyl)-, diethyl ester. CAS No. 20605-01-0. Pack Sizes: 500 g. Product ID: B2699-010716. Molecular formula: C9H16O6. Mole weight: 220.22. Custom synthesis is available. Send your inquiries for more information.
London
Diethyl carbonate
100g Pack Size. Group: Building Blocks, Organics. Formula: C5H10O3. CAS No. 105-58-8. Prepack ID : 89966665-100g. Molecular Weight : 118.13.
Diethyl cyanomethylphosphonate
100g Pack Size. Group: Building Blocks, Organics, Reagents. Formula: C6H12NO3P. CAS No. 2537-48-6. Prepack ID : 64731379-100g. Molecular Weight : 177.14.
Diethyl-D-tartrate
25g Pack Size. Group: Building Blocks, Chiral Compounds, Organics. Formula: C8H14O6. CAS No. 13811-71-7. Prepack ID : 19167747-25g. Molecular Weight : 206.19.
Di Ethylene Glycol (DEG)
Di Ethylene Glycol (DEG). At Tan International we supply a wide range of products covering all industry sectors
Scotland
Diethylene glycol dibutyl ether
Diethylene glycol dibutyl ether. CAS No. 112-73-2. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
500g Pack Size. Group: Analytical Reagents, Diagnostic Raw Materials, Solvents. Formula: C8H18O3. CAS No. 112-36-7. Prepack ID : 89967227-500g. Molecular Weight : 162.23.
Di(ethylene glycol) divinyl ether
Di(ethylene glycol) divinyl ether. CAS No. 764-99-8. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethylene Glycol Methyl Ethyl Ether
Diethylene Glycol Methyl Ethyl Ether. CAS No. 1002-67-1. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethylene glycol monobutyl ether
1kg Pack Size. Group: Building Blocks, Organics. Formula: C8H18O3. CAS No. 112-34-5. Prepack ID : 21823572-1kg. Molecular Weight : 162.23.
Diethyleneglycol monobutyl ether
Diethyleneglycol monobutyl ether. CAS No. 112-34-5. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethylene Glycol Monoethyl Ether
Diethylene Glycol Monoethyl Ether. CAS No. 111-90-0. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethylene glycol mono-methacrylate
Diethylene glycol mono-methacrylate has been utilized in the fabrication of pharmaceutical carriers designed for the regulated dissemination of pharmacological agents, notably for the management of enduring medical conditions like cancer. Group: Pharmaceutical. Alternative Names: 2-Propenoic acid, 2-methyl-, 2-(2-hydroxyethoxy)ethyl ester; PEG-2 methacrylate. CAS No. 2351-43-1. Pack Sizes: 500 mg. Product ID: B1370-007519. Molecular formula: C8H14O4. Mole weight: 174.19. Custom synthesis is available. Send your inquiries for more information.
London
Diethylene glycol monomethyl ether
100g Pack Size. Group: Analytical Reagents, Diagnostic Raw Materials, Solvents. Formula: C5H12O3. CAS No. 111-77-3. Prepack ID : 89967164-100g. Molecular Weight : 120.15.
Diethylene glycol monomethyl ether
500g Pack Size. Group: Analytical Reagents, Diagnostic Raw Materials, Solvents. Formula: C5H12O3. CAS No. 111-77-3. Prepack ID : 89967164-500g. Molecular Weight : 120.15.
Diethylenetriamine pentaacetic acid
1kg Pack Size. Group: Building Blocks, Ligands. Formula: C14H23N3O10. CAS No. 67-43-6. Prepack ID : 69522692-1kg. Molecular Weight : 393.35.
Diethylenetriamine penta (methylenephosphonic acid) pentasodium salt
Diethylenetriamine penta (methylenephosphonic acid) pentasodium salt. CAS No. 22042-96-2. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethylentriamine
Diethylentriamine. CAS No. 111-40-0. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethylethanolamine
Diethylethanolamine. CAS No. 100-37-8. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethylethanolamine Dicyclohexylketone
Diethylethanolamine Dicyclohexylketone is an impurity of Dicyclomine, which is an M1 and M2 muscarinic acetylcholine receptor antagonist. Group: Pharmaceutical. CAS No. 2731926-17-1. Pack Sizes: 100 mg. Product ID: B1370-286446. Molecular formula: C19H35NO2. Mole weight: 309.49. Custom synthesis is available. Send your inquiries for more information.
London
Diethyl ether
100ml Pack Size. Group: Building Blocks, Organics, Solvents. Formula: (CH3CH2)2O. CAS No. 60-29-7. Prepack ID : 25426302-100ml. Molecular Weight : 74.12.
DIETHYL ETHER AR
DIETHYL ETHER AR, UK suppliers of laboratory chemicals and apparatus needed
DIETHYL ETHER (TECHNICAL GRADE)
Is a organic compound in the ether class with the formula (C2H5)2O, sometimes abbreviated as Et2O. It is a colourless, highly volatile, sweet-smelling ("ethereal odour"), extremely flammable liquid. Uses: Laboratory chemicals, Industrial & for professional use. Alternative Names: Ether. CAS No. 60-29-7.
Diethyl ethoxy methyl enemalonate
100g Pack Size. Group: Building Blocks, Organics. Formula: C10H16O5. CAS No. 87-13-8. Prepack ID : 16946616-100g. Molecular Weight : 216.23.
Diethyl Ethylphosphonate
Diethyl Ethylphosphonate. CAS No. 78-38-6. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethylhydroxylamine 85%
Diethylhydroxylamine 85%. CAS No. 3710-84-7. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethyl isocyano methyl phosphonate, 97%
1g Pack Size. Group: Building Blocks, Organics. Formula: C6H12NO3P. CAS No. 41003-94-5. Prepack ID : 90027205-1g. Molecular Weight : 177.14 g/mol.
Diethyl (L)-tartrate
Diethyl (L)-tartrate. CAS No. 87-91-2. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethyl malonate
Diethyl malonate. CAS No. 105-53-3. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethyl Malonate
Diethyl Malonate Uses: Pharmaceutical R&D. Group: Intermediates. CAS No. 105-53-3. Pack Sizes: 200kg Drums. Categories: NORDMANN UK Fine Chemicals Suppliers.
UK / EU / USA / Japan
Diethyl Malonate
Diethyl Malonate. At Tan International we supply a wide range of products covering all industry sectors
Scotland
Diethyl malonate-[1,2,3-13C3]
Diethyl malonate-[1,2,3-13C3] is a labelled compound of Diethyl Malonate. Acylation of diethyl malonate using magnesium chloride and triethylamine is reported. Group: Pharmaceutical. Alternative Names: 13C Labeled diethyl malonate; 13C Labeled diethyl malonic acid; Malonic acid diethyl ester-13C3. CAS No. 53051-81-3. Pack Sizes: 1 g. Product ID: BLP-011108. Molecular formula: C4[13C]3H12O4. Mole weight: 163.15. Custom synthesis is available. Send your inquiries for more information.
Diethylmethyl(2-methoxyethyl)ammonium bis(trifluoromethylsulfonyl)imide. Group: Pharmaceutical. Alternative Names: N,N-Diethyl-N-methyl-N-(2-methoxyethyl)ammonium bis(trifluoromethanesulfonyl)imide. CAS No. 464927-84-2. Pack Sizes: 5 g. Product ID: B2699-189240. Molecular formula: C10H20F6N2O5S2. Mole weight: 426.4. Custom synthesis is available. Send your inquiries for more information.
London
Diethyl oxalate
1kg Pack Size. Group: Building Blocks, Organics. Formula: C6H10O4. CAS No. 95-92-1. Prepack ID : 31156858-1kg. Molecular Weight : 146.14.
Diethylphosphinic acid
Diethylphosphinic acid, a versatile compound, is a pivotal component in organic synthesis. Owing to its remarkable capability to act as a ligand in metal-catalyzed reactions, it accentuates molecular designing. Its scope has been broadened to pharmaceuticals too, where it is researched for its prospective utilization as a pain therapy and to eradicate inflammation among patients featuring neuropathic ailments. Group: Pharmaceutical. Alternative Names: diethyl-phosphinic acid; Phosphinic acid, P,P-diethyl-. CAS No. 813-76-3. Pack Sizes: 100 mg. Product ID: B0001-084500. Molecular formula: C4H11O2P. Mole weight: 122.1. Custom synthesis is available. Send your inquiries for more information.
London
Diethyl phosphite
Diethyl phosphite. CAS No. 762-04-9. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Diethyl phosphite
500g Pack Size. Group: Building Blocks, Organics. Formula: C4H11O3P. CAS No. 762-04-9. Prepack ID : 40923677-500g. Molecular Weight : 138.1.
Diethyl phthalate
500g Pack Size. Group: Building Blocks, Organics. Formula: C6H4-1,2-(CO2C2H5)2. CAS No. 84-66-2. Prepack ID : 31953402-500g. Molecular Weight : 222.24.
DIETHYL PHTHALATE
Is a phthalate ester. It occurs as a colourless liquid without significant odour but has a bitter, disagreeable taste. It is more dense than water and insoluble in water; hence, it sinks in water. Uses: Laboratory chemicals, manufacture of substances. Alternative Names: DEP. CAS No. 84-66-2.
Diethyl pimelate
25g Pack Size. Group: Building Blocks, Organics. Formula: C11H20O4. CAS No. 2050-20-6. Prepack ID : 25808608-25g. Molecular Weight : 216.27.
Diethyl propylmalonate
Diethyl propylmalonate Uses: Pharmaceutical Research and Development. Group: Intermediates. CAS No. 2163-48-6. Pack Sizes: Enquire for MOQ. Categories: Nordmann UK Fine Chemicals suppliers (Formerly Melrob-Eurolabs).
UK / EU / USA / Japan
Diethyl pyrocarbonate (DEPC)
100g Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: C6H10O5. CAS No. 1609-47-8. Prepack ID : 22057917-100g. Molecular Weight : 162.14.
Diethyl pyrocarbonate (DEPC)
25g Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: C6H10O5. CAS No. 1609-47-8. Prepack ID : 22057917-25g. Molecular Weight : 162.14.
Diethyl Succinate
Diethyl Succinate Uses: Pharmaceutical Research and Development. Group: Special Anhydrides. CAS No. 123-25-1. Pack Sizes: 220kg drums & IBC's. Categories: NORDMANN Key intermediates and specialty chemicals.
UK / EU / USA / Japan
Diethyl sulfone
100mg Pack Size. Group: Building Blocks, Organics. Formula: C4H10O2S. CAS No. 597-35-3. Prepack ID : 16682226-100mg. Molecular Weight : 122.19.
Diethyl sulfone
1g Pack Size. Group: Building Blocks, Organics. Formula: C4H10O2S. CAS No. 597-35-3. Prepack ID : 16682226-1g. Molecular Weight : 122.19.
Diethyl Sulphate, 99% Ps
100g Pack Size. Group: Building Blocks, Organics. Formula: C4H10O4S. CAS No. 64-67-5. Prepack ID : 65617544-100g. Molecular Weight : 154.18.
Diethyl Tenofovir
One impurity of Tenofovir, which is an acyclic phosphonate nucleotide derivative, could be used in antiviral treatment as an everse transcriptase inhibitor. Group: Pharmaceutical. Alternative Names: (R)-9-[2-(Diethylphosphonomethoxy)propyl] Adenine; P-[[(1R)-2-(6-Amino-9H-purin-9-yl)-1-methylethoxy]methyl]phosphonic Acid Diethyl Ester; [[(1R)-2-(6-Amino-9H-purin-9-yl)-1-methylethoxy]methyl]phosphonic Acid Diethyl Ester. CAS No. 180587-75-1. Pack Sizes: 100 mg. Product ID: B1707-234697. Molecular formula: C13H22N5O4P. Mole weight: 343.33. Custom synthesis is available. Send your inquiries for more information.
London
Diethyltoluamide
Diethyltoluamide is the most common active ingredient in many insect repellent products. Diethyltoluamide is also an effective solvent and may dissolve plastics, rayon, spandex, other synthetic fabrics and painted or varnished surfaces. Group: Pharmaceutical. Alternative Names: DEET; N,N-Diethyl-m-toluamide; 3-Methyl-N,N-diethylbenzamide; Metadelphene; Delphene; Flypel. CAS No. 134-62-3. Pack Sizes: 1mg;1g;10g. Product ID: 134-62-3. Molecular formula: C12H17NO. Mole weight: 191.27. Custom synthesis is available. Send your inquiries for more information.
London
Diethyl Toluenediamine
Diethyl Toluenediamine (DETDA). CAS No. 68479-98-1. Gantrade Suppliers of a broad range of Monomers, Intermediates & Polymers. Categories: Diethyl toluene diamine.
Worldwide
Difelikefalin
Difelikefalin is an analgesic opioid peptide acting as a peripherally specific, highly selective agonist of the κ-opioid receptor (KOR). It acts as an analgesic by activating KORs on peripheral nerve terminals and KORs expressed by certain immune system cells. It may be useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. It is under development by Cara Therapeutics as an intravenous agent for the treatment of postoperative pain. It lacks the central side effects due to its peripheral selectivity. It is also being investigated for the treatment of pruritus (itching). It has completed phase II clinical trials for postoperative pain and has demonstrated significant and "robust" clinical efficacy, along with being safe and well-tolerated. It is also in phase II clinical trials for uremic pruritus in hemodialysis patients. Uses: Difelikefalin may be useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. it is used as an intravenous agent for the treatment of postoperative pain. it is also being investigated for the treatment of pruritus (itching). Group: Pharmaceutical. Alternative Names: N1-(D-Phenylalanyl-D-phenylalanyl-D-leucyl-D-lysyl)-4-amino-4-piperidinecarboxylic acid; CR 845; D-Phe-D-Phe-D-Leu-D-Lys-[gamma-(4-N-piperidinyl)amino carboxylic acid]; 1-(D-Phenylalanyl-D-phenylalanyl-D-leucy
London
Difenamizole
Difenamizole is a non-steroidal anti-inflammatory drug (NSAID) and analgesic of the pyrazolone group related to metamizole. Group: Pharmaceutical. Alternative Names: 2-(dimethylamino)-N-(2,5-diphenylpyrazol-3-yl)propanamide; Difenamizole; Difenamizole [INN]; Difenamizolum; BRN 0698538; Diphenamizole; Pasalin; UNII-24MR6YLL3W; BRN-0698538; BRN0698538. CAS No. 20170-20-1. Pack Sizes: 1mg;1g;10g. Product ID: 20170-20-1. Molecular formula: C20H22N4O. Mole weight: 334.415. Custom synthesis is available. Send your inquiries for more information.
London
Difethialone
Difethialone is an anticoagulant used as an rodenticide. Group: Pharmaceutical. Alternative Names: 3-[3-[4-(4-bromophenyl)phenyl]-1,2,3,4-tetrahydronaphthalen-1-yl]-2-hydroxythiochromen-4-one. CAS No. 104653-34-1. Pack Sizes: 1mg;1g;10g. Product ID: 104653-34-1. Molecular formula: C31H23BrO2S. Mole weight: 539.487. Custom synthesis is available. Send your inquiries for more information.
London
Difloxacin-[d3] Hydrochloride
Difloxacin-[d3] Hydrochloride is a labelled Difloxacin hydrochloride, which is a fluoroquinolone antibiotic commonly used in veterinary medicine. Group: Pharmaceutical. Alternative Names: Difloxacin D3 Hydrochloride. CAS No. 1173021-89-0. Pack Sizes: 10 mg. Product ID: BLP-012314. Molecular formula: C21H17D3ClF2N3O3. Mole weight: 438.87. Custom synthesis is available. Send your inquiries for more information.
London
Difloxacin Hydrochloride
A fluoroquinolone antibiotic commonly used in veterinary medicine. It is an inhibitor of Topo II. Group: Pharmaceutical. Alternative Names: 6-Fluoro-1-(4-fluorophenyl)-1,4-dihydro-7-(4-methylpiperazino)-4-oxo-3-quinolinecarboxylic acid hydrochloride; Difloxacin HCl. CAS No. 91296-86-5. Pack Sizes: 1mg;1g;10g. Product ID: BBF-04642. Molecular formula: C21H19F2N3O3.HCl. Mole weight: 435.85. Custom synthesis is available. Send your inquiries for more information.
London
Diflubenzuron
Diflubenzuron is a benzoylurea-type insecticide of the benzamide class. The mechanism of action of diflubenzuron involves inhibiting the production of chitin which is used by an insect to build its exoskeleton. Group: Pharmaceutical. Alternative Names: Difluron; Dimilin; Larvakil; N-[(4-chlorophenyl)carbamoyl]-2,6-difluorobenzamide. CAS No. 35367-38-5. Pack Sizes: 1mg;1g;10g. Product ID: 35367-38-5. Molecular formula: C14H9ClF2N2O2. Mole weight: 310.685. Custom synthesis is available. Send your inquiries for more information.
1g Pack Size. Group: Analytical Reagents, Building Blocks. Formula: C14H9ClF2N2O2. CAS No. 35367-38-5. Prepack ID : 12617635-1g. Molecular Weight : 310.68.
Difluoromethanesulfonyl chloride
Difluoromethanesulfonyl chloride. CAS No. 1512-30-7. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Difluoromethyl sulfonyl chloride
Difluoromethyl sulfonyl chloride. CAS No. 1512-30-7. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications.
Cenik Chemicals
Difluprednate
1g Pack Size. Group: Bioactive Small Molecules, Biochemicals, Research Organics & Inorganics. Formula: C27H34F2O7. CAS No. 23674-86-4. Prepack ID : 47585639-1g. Molecular Weight : 508.55.
Difopein
Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Group: Pharmaceutical. Alternative Names: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG. CAS No. 396834-58-5. Pack Sizes: 1 mg. Product ID: BAT-010334. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17. Custom synthesis is available. Send your inquiries for more information.
London
DIGITAL STOPWATCH, 12mm
DIGITAL STOPWATCH, 12mm, UK suppliers of laboratory chemicals wanted
DIGITAL STOPWATCH, 24hr
DIGITAL STOPWATCH, 24hr, UK suppliers of laboratory chemicals and apparatus needed
Digitonin
1g Pack Size. Group: Biochemicals, Research Organics & Inorganics. Formula: C56H92O29. CAS No. 11024-24-1. Prepack ID : 84387497-1g. Molecular Weight : 1229.31.
Digitoxin
1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C41H64O13. CAS No. 71-63-6. Prepack ID : 60859961-1g. Molecular Weight : 764.94.
Diglycidyl Terephthalate
Diglycidyl Terephthalate (DGT) is a monomeric compound utilized for producing high-thermal resistant polymers. As a cross-linking agent in polymerization reactions, DGT generates robust materials with exceptional stability and durability. Furthermore, its multifunctional properties make it ideal for developing composite materials, particularly in the aerospace and industrial sectors. The capability of DGT to enhance the overall performance of materials is significant, and its applications are diverse. Group: Pharmaceutical. Alternative Names: Bis(2,3-epoxypropyl) terephthalate; Terephthalic acid diglycidyl ester. CAS No. 7195-44-0. Pack Sizes: 500 mg. Product ID: B2699-315506. Molecular formula: C14H14O6. Mole weight: 278.26. Custom synthesis is available. Send your inquiries for more information.
London
Digoxin
1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C41H64O14. CAS No. 20830-75-5. Prepack ID : 24736068-1g. Molecular Weight : 780.94.