difopein Suppliers UK

Find where to buy products from UK suppliers, including: distributors, industrial manufacturers, wholesalers, raw ingredients, bulk supplies and finished goods for sale.

Search for products or services, then visit the suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the USA.

Product
Difopein Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Group: Pharmaceutical. Alternative Names: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG. CAS No. 396834-58-5. Pack Sizes: 1 mg. Product ID: BAT-010334. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17. Custom synthesis is available. Send your inquiries for more information. BOC Sciences
London

Would you like to list your products on UK Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products