BOC Sciences - Products
London
BOC Sciences provides various research (bio)chemicals: inhibitors, building blocks, carbohydrates, nucleosides, nucleotides, GMP Products, impurities, metabolites, APIs, natural compounds, ADCs, and chiral compounds.
| Product | Description | |
|---|---|---|
| D-(+)-Glucono-1,5-lactone | A lactone (cyclic ester) of D-gluconic acid used as a sequestrant, an acidifier, or a curing, pickling, or leavening agent. Group: Pharmaceutical. Alternative Names: Canagliflozin Related Impurity 8; Gluconolactone; Gluconic acid lactone; D-(+)-Glucono-δ-lactone. CAS No. 90-80-2. Pack Sizes: 1 kg. Product ID: B1370-100376. Molecular formula: C6H10O6. Mole weight: 178.14. Custom synthesis is available. Send your inquiries for more information. |  London |
| D-Glucose-6-phosphate dipotassium salt trihydrate | D-Glucose-6-phosphate dipotassium salt trihydrate is a pivotal compound extensively employed in the biomedical research and pharmaceutical industry, unveiling noteworthy potential in investigating intricate metabolic disorders and glucose metabolism. This paramount product seamlessly acts as a substrate for a diverse array of enzymes, facilitating the meticulous identification and characterization of pertinent pathways germane to therapeutic drug development of afflictions such as diabetes and glycogen storage diseases. Group: Pharmaceutical. Alternative Names: D-Glucose 6-phosphate Dipotassium Salt Trihydrate; Potassium (2R,3R,4S,5R)-2,3,4,5-tetrahydroxy-6-oxohexyl phosphate trihydrate; AC8158; D-Glucose-6-phosphatedipotassiumsalttrihydrate; a-D-Glucose-6-phosphate dipotassium salt hydrate. CAS No. 207727-36-4. Pack Sizes: 250 mg. Product ID: B2705-101654. Molecular formula: C6H17K2O12P. Mole weight: 390.36. Custom synthesis is available. Send your inquiries for more information. | London |
| D-(+)-Glucurono-3,6-lactone | D-(+)-Glucurono-3,6-lactone is used for treating canine hepatitis. Group: Pharmaceutical. Alternative Names: (2R)-2-[(2S,3R,4S)-3,4-dihydroxy-5-oxo-2-oxolanyl]-2-hydroxyacetaldehyde; D-Glucuronic acid, γ-lactone; D-Glucofuranurono-6,3-lactone; D-Glucuronic acid lactone; D-Glucurono-6,3-lactone; D-Glucurono-γ-lactone; D-Glucuronolactone; Dicurone; Glucoxy; Glucurolactone; Glucurone; Glucuronolactone; Guronsan; NSC 656. CAS No. 32449-92-6. Pack Sizes: 1 kg. Product ID: 32449-92-6. Molecular formula: C6H8O6. Mole weight: 176.12. Custom synthesis is available. Send your inquiries for more information. | London |
| D-GsMTx4 | D-GsMTx4 is a mechanosensitive and stretch-activated ion channel inhibitor. It is used as a tool for identifying the role of these excitatory MSCs in normal physiology and pathology. Group: Pharmaceutical. Pack Sizes: 1 mg. Product ID: BAT-006149. Molecular formula: C185H273N49O45S6. Mole weight: 4095.86. Custom synthesis is available. Send your inquiries for more information. | London |
| DHBP dibromide | DHBP dibromide blocks calcium release from sarcoplasmic reticulum by direct interaction with the ryanodine receptor. Group: Pharmaceutical. Alternative Names: Diheptylviologen dibromide; 1,1'-Diheptyl-4,4'-bipyridinium Dibromide; Diheptylviologen Bromide; Heptylviologen Bromide; Heptylviologen Dibromide; N,N'-Diheptyl-4,4'-bipyridinium Dibromide; N,N'-Diheptyl-4,4'-dipyridinium Dibromide; 1,1'-Diheptyl-[4,4'-bipyridine]-1,1'-diium bromide. CAS No. 6159-5-3. Pack Sizes: 25 g. Product ID: B1370-030052. Molecular formula: C24H38Br2N2. Mole weight: 514.39. Custom synthesis is available. Send your inquiries for more information. | London |
| D-His(1)-Semaglutide | D-[His]-1-Semaglutide is an impurity of Semaglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist used to treat type 2 diabetes. Group: Pharmaceutical. Alternative Names: Semaglutide SZ Impurity 6; Semaglutide D-His-7 Impurity; D-His(7)-Semaglutide; D-[His]-1-Semaglutide; D-Histidyl-2-methylalanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-N6-[N-(17-carboxy-1-oxoheptadecyl)-L-γ-glutamyl-2-[2-(2-aminoethoxy)ethoxy]acetyl-2-[2-(2-aminoethoxy)ethoxy]acetyl]-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-arginylglycyl-L-arginylglycine; H-D-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH. Pack Sizes: 5 mg. Product ID: B1370-425567. Molecular formula: C187H291N45O59. Mole weight: 4113.64. Custom synthesis is available. Send your inquiries for more information. | London |
| D-Homocysteine Lactone HCl | D-Homocysteine Lactone HCl is one of Cysteine impurities. It has potential anticancer activity against tumor cell growth. Group: Pharmaceutical. Alternative Names: (3R)-3-Aminodihydro-2(3H)-furanone hydrochloride (1:1); (R)-(+)-α-amino-γ-butyrolactone hydrochloride; 2(3H)-Furanone, 3-aminodihydro-, (3R)-, hydrochloride (1:1); (3R)-3-aminotetrahydrofuran-2-one hydrochloride; (R)-2-Amino-4-butyrolactone hydrochloride. CAS No. 104347-13-9. Pack Sizes: 1mg;1g;10g. Product ID: BAT-015038. Molecular formula: C4H7NO2.HCl. Mole weight: 137.56. Custom synthesis is available. Send your inquiries for more information. | London |
| (DHQ)2PHAL | (DHQ)2PHAL is a ligand for Sharpless Asymmetric Dihydroxylation. Uses: (dhq)2phal is a ligand for sharpless asymmetric dihydroxylation. Group: Pharmaceutical. Alternative Names: AD-mix-alpha; Hydroquinine 1,4-phthalazinediyl diether; 4-[(R)-[(2R,4R,5S)-5-ethyl-1-azabicyclo[2.2.2]octan-2-yl]-(6-methoxyquinolin-4-yl)methoxy]-1-[(R)-[(2R,4S,5R)-5-ethyl-1-azabicyclo[2.2.2]octan-2-yl]-(6-methoxyquinolin-4-yl)methoxy]phthalazine. CAS No. 140924-50-1. Pack Sizes: 2 g. Product ID: B2699-009429. Molecular formula: C48H54N6O4. Mole weight: 779. Custom synthesis is available. Send your inquiries for more information. | London |
| Di-(2-pyridyl)(dicyclohexylphosphino)amine | Di-(2-pyridyl)(dicyclohexylphosphino)amine, a chemical compound often employed in the biomedicine sector, acts as an adept ligand for palladium-catalyzed C-N and C-C bond formation reactions, rendering it especially valuable in the creation of heterocyclic compounds. This product boasts widespread usage in the role of a catalyst and can even be utilized for the treatment of specific strains of cancer, such as breast cancer, owing to its exceptional medicinal characteristics. Group: Pharmaceutical. Alternative Names: N-(Dicyclohexylphosphino)-N-(pyridin-2-yl)pyridin-2-amine. CAS No. 472959-98-1. Pack Sizes: 100 mg. Product ID: B2699-238735. Molecular formula: C22H30N3P. Mole weight: 367.47. Custom synthesis is available. Send your inquiries for more information. | London |
| Diacerein | Diacerin is an inhibitor of pro-inflammatory cytokine Interleukin-1B (IL-1B) production, prescribed for osteoarthritis and chronic inflammatory arthritis. Uses: Treatment of osteoarthritis. Group: Pharmaceutical. Alternative Names: Artrodar; Fisiodar; SF-277; Verboril; 4,5-Bis(acetyloxy)-9,10-dihydro-9,10-dioxo-2-anthracenecarboxylic Acid. CAS No. 13739-02-1. Pack Sizes: 100 g. Product ID: B1370-058058. Molecular formula: C19H12O8. Mole weight: 368.29. Custom synthesis is available. Send your inquiries for more information. | London |
| (Diacetoxyiodo)benzene | (Diacetoxyiodo)benzene. Group: Pharmaceutical. Alternative Names: Iodobenzene diacetate; Iodosobenzene diacetate; Phenyliodo diacetate. CAS No. 3240-34-4. Pack Sizes: 1k g. Product ID: B1370-176828. Molecular formula: C10H11IO4. Mole weight: 322.1. Custom synthesis is available. Send your inquiries for more information. | London |
| (Diacetyl)-α-MSH | (Diacetyl)-α-MSH, a synthetic peptide, has been investigated extensively for its prospective applications in the management of autoimmune and inflammatory ailments, like rheumatoid arthritis and multiple sclerosis. Its anti-inflammatory properties and the ability to modulate the immune system by regulating cytokine production have been well documented. Furthermore, its efficacy as a treatment option for melanoma and obesity has been studied due to its influence on melanocortin receptors. The compound offers remarkable potential as an agent for mitigating various diseases. Group: Pharmaceutical. Alternative Names: a-Melanotropin (swine), 1-(N,O-diacetyl-L-serine)-; Ac-Ser(Ac)-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2. CAS No. 71952-90-4. Pack Sizes: 5 mg. Product ID: BAT-006209. Molecular formula: C79H111N21O20S. Mole weight: 1706.92. Custom synthesis is available. Send your inquiries for more information. | London |
| Diacetylkorseveriline | Diacetylkorseveriline is an antiarrhythmic (classes i and iv), belonging to a novel structural class. effective against arrhythmia caused by aconitine,CaCl2, electric stimulation of the ventricles or ligature of the aorta, recommended dose for one cycle of experiment on mice: 3. 0-30. 0 mg/kg, intravenously. Group: Pharmaceutical. Alternative Names: Cevane-3,6,14-triol, 3,6-diacetate, (3α,5α,6β,25α)- (9CI). CAS No. 21851-07-0. Pack Sizes: 1mg;1g;10g. Product ID: 21851-07-0. Molecular formula: C31H49NO4. Mole weight: 499.73. Custom synthesis is available. Send your inquiries for more information. | London |
| Dialdehyde starch | Dialdehyde starch is a biocompatible polymer used in biomedical field for drug delivery systems. With excellent stability and biodegradability, it enables controlled drug release, especially for anticancer compounds like doxorubicin and paclitaxel. Group: Pharmaceutical. Alternative Names: Starch, 2,3-dialdehydo; Sumstar; Dialdehydostarch; 2,3-Dialdehyde starch; 2,3-Dialdehydostarch; Caldas 10; DAS 100; Formamyl; Periodate starch; Polyaldehyde starch; Starch dialdehyde; Starch-2,3-dialdehyde; Sumstar 150; Sumstar 190. CAS No. 9047-50-1. Pack Sizes: 100 g. Product ID: B1370-330967. Custom synthesis is available. Send your inquiries for more information. | London |
| Diamfenetide | Diamfenetide is a fasiolicide used in sheep to treat immature fluke infections. Group: Pharmaceutical. Alternative Names: Acemidophene; Diamphenethide; Coryphamin. CAS No. 36141-82-9. Pack Sizes: 25 mg. Product ID: B2692-019135. Molecular formula: C20H24N2O5. Mole weight: 372.419. Custom synthesis is available. Send your inquiries for more information. | London |
| Diarylcomosol III | Diarylcomosol III is a natural compound isolated from the dried rhizomes of Curcuma comosa. Diarylcomosol III shows inhibitory effects on melanogenesis in B16 melanoma cells, and it is a promising therapeutic agent for the treatment of skin disorders. Group: Pharmaceutical. Alternative Names: (3R,5S)-1-(4-hydroxy-3,5-dimethoxyphenyl)-7-(4-hydroxyphenyl)heptane-3,5-diol. CAS No. 1452487-93-2. Pack Sizes: 5 mg. Product ID: NP4832. Molecular formula: C21H28O6. Mole weight: 376.44. Custom synthesis is available. Send your inquiries for more information. | London |
| Diatrizoate meglumine | Diatrizoate is a contrast agent used during X-rays for visualizing veins, the urinary system, spleen, and joints, as well as during computer tomography (CT scan). Group: Pharmaceutical. Alternative Names: Angiografin; Renografin. CAS No. 131-49-7. Pack Sizes: 50 g. Product ID: B2692-048260. Molecular formula: C11H9I3N2O4 C7H17NO5. Mole weight: 809.17. Custom synthesis is available. Send your inquiries for more information. | London |
| DiAzKs hydrochloride | DiAzKs is a diazirine-containing lysine amino acid and is a photo-cross-linker used to crosslink protein-protein interactions in vitro and in living cells. Group: Pharmaceutical. Alternative Names: H-L-photo-lysine HCl; N6-((2-(3-Methyl-3H-diazirin-3-yl)ethoxy)carbonyl)-L-lysine hydrochloride. CAS No. 2421187-79-1. Pack Sizes: 50 mg. Product ID: BAT-014390. Molecular formula: C11H21ClN4O4. Mole weight: 308.76. Custom synthesis is available. Send your inquiries for more information. | London |
| Diazoxide | Diazoxide is a potassium channel activator that causes local relaxation in smooth muscle by increasing membrane permeability to potassium ions. The cellular release of potassium switches off voltage-gated calcium ion channels which inhibits the generation of an action potential. Uses: Antihypertensive agents. Group: Pharmaceutical. Alternative Names: 7-Chloro-3-methyl-4H-1,2,4-benzothiadiazine 1,1-dioxide. CAS No. 364-98-7. Pack Sizes: 2 g. Product ID: B0084-474147. Molecular formula: C8H7ClN2O2S. Mole weight: 230.7. Custom synthesis is available. Send your inquiries for more information. | London |
| (+)-Dibenzoyl-D-tartaric Acid | Reagent used to produce chiral salts. Group: Pharmaceutical. Alternative Names: (2S,3S)-2,3-dibenzoyloxybutanedioic acid; (2S,3S)-2,3-dibenzoyloxybutanedioic acid. CAS No. 17026-42-5. Pack Sizes: 1 kg. Product ID: B2699-085616. Molecular formula: C18H14O8. Mole weight: 358.3. Custom synthesis is available. Send your inquiries for more information. | London |
| Dibritannilactone B | Dibritannilactone B is isolated from the aerial parts of Inula britannica. Group: Pharmaceutical. CAS No. 1829580-18-8. Pack Sizes: 1 mg. Product ID: NP5956. Molecular formula: C34H46O9. Mole weight: 598.733. Custom synthesis is available. Send your inquiries for more information. | London |
| Dibutyl(2-ethoxy-2-oxoethyl)phenethylammonium chloride | Dibutyl(2-ethoxy-2-oxoethyl)phenethylammonium chloride is a useful research chemical. Group: Pharmaceutical. Alternative Names: Dibutyl(2-ethoxy-2-oxoethyl)phenethylammoniumchloride. CAS No. 94157-98-9. Pack Sizes: 100 g. Product ID: B1370-250842. Molecular formula: C20H34ClNO2. Mole weight: 355.9. Custom synthesis is available. Send your inquiries for more information. | London |
| Dicalcium silicate | Dicalcium silicate is used as an auxiliary filler for oral pharmaceuticals. It is also used as an antacid in pharmaceutical preparations, and as an anti-caking agent. Group: Pharmaceutical. Alternative Names: Calcium diorthosilicate; Silicic acid, calcium salt (1:2); belite; Dicalcium orthosilicate. CAS No. 10034-77-2. Pack Sizes: 10 g. Product ID: B0001-072020. Molecular formula: Ca2SiO4. Mole weight: 172.24. Custom synthesis is available. Send your inquiries for more information. | London |
| Dicamba-methyl ester-[d6] | Dicamba-methyl ester-[d6] is a labelled analogue of Dicamba-methyl ester, a chlorinated acidic herbicide, which exists as a persistent contaminant in the environment. Group: Pharmaceutical. Pack Sizes: 10 mg. Product ID: BLP-008844. Molecular formula: C9H2D6Cl2O3. Mole weight: 241.1. Custom synthesis is available. Send your inquiries for more information. | London |
| Dicentrin | Dicentrine is an alkaloid showing antihypertensive effect. Group: Pharmaceutical. Alternative Names: L-DICENTRINE; d-Dicentrine; Eximine. CAS No. 517-66-8. Pack Sizes: 1 mg. Product ID: NP0094. Molecular formula: C20H21NO4. Mole weight: 339.4. Custom synthesis is available. Send your inquiries for more information. | London |
| Dichlormate | Dichlormate is a herbicide. Group: Pharmaceutical. Alternative Names: Sirmate; 3,4-Sirmate; 3,4-Dichlorobenzyl methylcarbamate; (3,4-dichlorophenyl)methyl N-methylcarbamate. CAS No. 1966-58-1. Pack Sizes: 100 mg. Product ID: B0046-263631. Molecular formula: C9H9Cl2NO2. Mole weight: 234.08. Custom synthesis is available. Send your inquiries for more information. | London |
| Dichloro[1,3-bis(2,4,6-trimethylphenyl)-2-imidazolidinylidene](benzylidene)bis(3-bromopyridine)ruthenium(II) | Dichloro[1,3-bis(2,4,6-trimethylphenyl)-2-imidazolidinylidene](benzylidene)bis(3-bromopyridine)ruthenium(II) (CAS# 900169-53-1 ) is a useful research chemical. Group: Pharmaceutical. Alternative Names: Grubbs Catalyst, 3nd Generation. CAS No. 900169-53-1. Pack Sizes: 1 g. Product ID: B2699-194109. Molecular formula: C38H40Br2Cl2N4Ru. Mole weight: 884.54. Custom synthesis is available. Send your inquiries for more information. | London |
| Dichlorprop-butotyl | Dichlorprop-butotyl is an herbicide. Group: Pharmaceutical. Alternative Names: 2-(2,4-Dichlorophenoxy) propionic acid-2-butoxyethyl ester. CAS No. 53404-31-2. Pack Sizes: 1mg;1g;10g. Product ID: 53404-31-2. Molecular formula: C15H20Cl2O4. Mole weight: 335.221. Custom synthesis is available. Send your inquiries for more information. | London |
| Dichotomitin | Dichotomitin is an isoflavonoid isolated from the rhizomes of Belamcanda chinensis (L.) DC. Group: Pharmaceutical. Alternative Names: 9-hydroxy-7-(3-hydroxy-4,5-dimethoxyphenyl)-8H-[1,3]dioxolo[4,5-g]chromen-8-one; 5,3'-Dihydroxy-4',5'-dimethoxy-6,7-methylenedioxyisoflavone; 8H-1,3-Dioxolo(4,5-g)(1)benzopyran-8-one, 9-hydroxy-7-(3-hydroxy-4,5-dimethoxyphenyl)-. CAS No. 88509-91-5. Pack Sizes: 5 mg. Product ID: B2703-465889. Molecular formula: C18H14O8. Mole weight: 358.3. Custom synthesis is available. Send your inquiries for more information. | London |
| Diclofenac Diethylamine | Diclofenac diethylamine is a nonsteroidal anti-inflammatory drug taken to reduce inflammation and as an analgesic reducing pain in certain conditions. Uses: Nsaid. Group: Pharmaceutical. Alternative Names: Diclofenac (diethylamine); UNII-6TGQ35Z71K; AK163134; Diclofenacdiethylamine. CAS No. 78213-16-8. Pack Sizes: 5 g. Product ID: B0084-077269. Molecular formula: C18H22Cl2N2O2. Mole weight: 369.29. Custom synthesis is available. Send your inquiries for more information. | London |
| Diclofenac EP Impurity C | Diclofenac EP Impurity C is an impurity of Diclofenac, which is a non-selective COX inhibitor used as a non-steroidal anti-inflammatory drug (NSAID). Group: Pharmaceutical. Alternative Names: Diclofenac sodium EP impurity C; Diclofenac potassium EP impurity C; Diclofenac Impurity C; [2-[(2,6-dichlorophenyl)amino]phenyl]methanol; 2-[(2,6-Dichlorophenyl)amino]benzenemethanol; Diclofenac Alcohol (Diclofenac Impurity); Benzenemethanol, 2-[(2,6-dichlorophenyl)amino]-; Benzyl alcohol, o-(2,6-dichloroanilino)-; Diclofenac alcohol analog. CAS No. 27204-57-5. Pack Sizes: 100 mg. Product ID: B2694-470082. Molecular formula: C13H11Cl2NO. Mole weight: 268.14. Custom synthesis is available. Send your inquiries for more information. | London |
| Diclofenac EP Impurity E | Diclofenac EP Impurity E is an impurity of Diclofenac, which is a non-selective COX inhibitor used as a non-steroidal anti-inflammatory drug (NSAID). Group: Pharmaceutical. Alternative Names: Diclofenac sodium EP impurity E; Diclofenac potassium EP impurity E; 1,3-dihydro-2H-indol-2-one; 2H-Indol-2-one, 1,3-dihydro-; 1,3-Dihydro-2H-indol-2-one; 2-Indolinone; Oxindole; 2,3-Dihydro-1H-indol-2-one; 2-Indolone; 2-Oxindole; 2-Oxo-2,3-dihydroindole; 2-Oxoindole; 2-Oxoindoline; Indol-2(3H)-one; Indoline-2-one; NSC 274863; Oxindol. CAS No. 59-48-3. Pack Sizes: 1mg;1g;10g. Product ID: NP0047. Molecular formula: C8H7NO. Mole weight: 133.15. Custom synthesis is available. Send your inquiries for more information. | London |
| Diclofenac epolamine | Diclofenac Epolamine is a non-steroidal anti-inflammatory agent (NSAID) with antipyretic and analgesic effects. Group: Pharmaceutical. Alternative Names: DHEP; DIEP; Diclofenac hydroxyethylpyrrolidine; Flector; UNII-X5F8EKL9ZG; X5F8EKL9ZG; Diclofenac-N-(2-hydroxyethyl) pyrrolidine. CAS No. 119623-66-4. Pack Sizes: 1 g. Product ID: B2692-055485. Molecular formula: C20H24Cl2N2O3. Mole weight: 411.32. Custom synthesis is available. Send your inquiries for more information. | London |
| Diclofenac Potassium | Diclofenac potassium is a nonsteroidal anti-inflammatory drug (NSAID) taken to reduce inflammation and as an analgesic reducing pain in certain conditions. It is a competitive inhibitor of cyclooxygenase (COX) that suppresses the production of prostaglandins. Diclofenac potassium induces apoptosis of neural stem cells (NSCs) via the activation of the caspase cascade. Uses: Nsaid. Group: Pharmaceutical. Alternative Names: 2-[(2,6-Dichlorophenyl)amino]benzeneacetic Acid Potassium Salt; [o-(2,6-Dichloroanilino)phenyl]acetic Acid Monopotassium Salt; 2-[(2,6-Dichlorophenyl)amino]benzeneacetic Acid Monopotassium Salt; Caflam; Cataflam; K-fenak; Potassium diclofenac. CAS No. 15307-81-0. Pack Sizes: 20 g. Product ID: B0084-059596. Molecular formula: C14H10Cl2KNO2. Mole weight: 334.24. Custom synthesis is available. Send your inquiries for more information. | London |
| Dicloxacillin | Dicloxacillin, a β-lactamase resistant penicillin similar to oxacillin, used to treat infections caused by susceptible (non-resistant) Gram-positive bacteria. Uses: Used as an antibiotic especially against gram-positive bacteria and also be significant in biological studies. Group: Pharmaceutical. Alternative Names: Veracillin, BRL1702; BRL 1702; BRL-1702;(2S,5R,6R)-6-[[3-(2,6-dichlorophenyl)-5-methyl-1,2-oxazole-4-carbonyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid. CAS No. 3116-76-5. Pack Sizes: 1mg;1g;10g. Product ID: BBF-01839. Molecular formula: C19H17Cl2N3O5S. Mole weight: 470.32. Custom synthesis is available. Send your inquiries for more information. | London |
| Dicresulene | Dicresulene is an impurity of Policresulen, a topical hemostatic and antiseptic. Group: Pharmaceutical. Alternative Names: 2-hydroxy-5-[(4-hydroxy-2-methyl-5-sulfophenyl)methyl]-4-methylbenzenesulfonic acid. CAS No. 78480-14-5. Pack Sizes: 25 mg. Product ID: B2694-033094. Molecular formula: C15H16O8S2. Mole weight: 388.4. Custom synthesis is available. Send your inquiries for more information. | London |
| Dictysine | Dictysine is an intricate and efficacious natural compound for studying diverse cancer types. Group: Pharmaceutical. Alternative Names: Dictyzine; 7,20-Cycloatidane-15,16,17-triol, 4,21-dimethyl-, (15beta)-; 8,10a-Ethano-11,3,6a-ethanylylidene-8H-indeno(2,1-b)azocine-9,10-diol, dodecahydro-9-(hydroxymethyl)-1,3-dimethyl-, (3R,6aS,6bS,8S,9R,10S,10aR,11R,11aR,13R)-. CAS No. 67256-05-7. Pack Sizes: 1 mg. Product ID: NP0622. Molecular formula: C21H33NO3. Mole weight: 347.499. Custom synthesis is available. Send your inquiries for more information. | London |
| Dicyclomine-[d4] Hydrochloride | Dicyclomine-[d4] Hydrochloride is a deuterium labelled form of Dicyclomine. Dicyclomine is a medication that is used to treat spasms of the intestines such as occur in irritable bowel syndrome. Dicyclomine is an M1 and M2 muscarinic acetylcholine receptor antagonist. Group: Pharmaceutical. Alternative Names: Dicyclomine-d4 Hydrochloride. Pack Sizes: 10 mg. Product ID: BLP-005108. Molecular formula: C19H32D4ClNO2. Mole weight: 349.97. Custom synthesis is available. Send your inquiries for more information. | London |
| Didemethyl citalopram | Didemethyl citalopram is a metabolite of Citalopram, an inhibitor of serotonin (5-HT) uptake. Used as an antidepressant. Group: Pharmaceutical. Alternative Names: Didesmethyl citalopram. CAS No. 62498-69-5. Pack Sizes: 500 mg. Product ID: B2694-039823. Molecular formula: C18H17FN2O. Mole weight: 296.34. Custom synthesis is available. Send your inquiries for more information. Categories: Didemethylcitalopram. | London |
| Didemnin B | Didemnin B is a cyclic depsipeptide isolated from the extract of Trididemnum solidum. It exhibits antiviral and antineoplastic effects. Group: Pharmaceutical. Alternative Names: N-(L-Lac-L-Pro-N-Methyl-D-Leu-)cyclo[L-Thr*-[(3S,4R)-3-hydroxy-4-[(S)-1-methylpropyl]-γAbu-]-[(2S,4S)-4-hydroxy*-2,5-dimethyl-3-oxohexanoyl]-L-Leu-L-Pro-N,O-dimethyl-L-Tyr-]; NSC-325319; Didemnin A, N-(1-(2-hydroxy-1-oxopropyl)-L-prolyl)-, (S)-. CAS No. 77327-05-0. Pack Sizes: 1 mg. Product ID: BBF-04477. Molecular formula: C57H89N7O15. Mole weight: 1112.36. Custom synthesis is available. Send your inquiries for more information. | London |
| Didesmethyl chlorpromazine HCl | Didesmethylchlorpromazine Hydrochloride is an impurity of Chlorpromazine, an antipsychotic medication used for the treatment of psychotic disorders such as schizophrenia. Group: Pharmaceutical. Alternative Names: Didesmethylchlorpromazine Hydrochloride; 3-(2-chlorophenothiazin-10-yl)propan-1-amine hydrochloride; 10-(3-Aminopropyl)-2-chloro-phenothiazine Monohydrochloride; NSC 168977; SKF 4577A; 10H-Phenothiazine-10-propanamine, 2-chloro-, monohydrochloride; Propylamine, 3-(2-chloro-10-phenothiazinyl)-, hydrochloride. CAS No. 3763-80-2. Pack Sizes: 100 mg. Product ID: B0598-284951. Molecular formula: C15H16Cl2N2S. Mole weight: 327.27. Custom synthesis is available. Send your inquiries for more information. | London |
| Didestriazole Anastrozole Dimer Impurity | Didestriazole Anastrozole Dimer Impurity is an impurity of Anastrozole, which is a medication used for the treatment of breast cancer in women after menopause. Group: Pharmaceutical. Alternative Names: α1-[[3-(1-Cyano-1-methylethyl)-5-methylphenyl]methyl]-α1,α3,α3,5-tetramethyl-1,3-benzenediacetonitrile; Anastrozole Impurity A; 1,3-Benzenediacetonitrile, α1-[[3-(1-cyano-1-methylethyl)-5-methylphenyl]methyl]-α1,α3,α3,5-tetramethyl-; 2,3-Bis[3-(2-cyano-2-propanyl)-5-methylphenyl]-2-methylpropanenitrile; 2,2'-[(2-Cyanopropane-1,2-diyl)bis(5-methyl-3,1-phenylene)]bis(2-methylpropanenitrile). CAS No. 918312-71-7. Pack Sizes: 10 mg. Product ID: B2694-466615. Molecular formula: C26H29N3. Mole weight: 383.54. Custom synthesis is available. Send your inquiries for more information. | London |
| DIDNTB | DIDNTB is a fluorescent dye used for staining proteins. Group: Pharmaceutical. Alternative Names: 4,5,6,7-Tetrabromo-3,3-bis(4-hydroxy-3-iodo-5-nitrophenyl)-3H-benzo[c][1,2]oxathiole 1,1-dioxide. CAS No. 145551-16-2. Pack Sizes: 250 mg. Product ID: B0001-258207. Molecular formula: C19H6Br4I2N2O9S. Mole weight: 1011.747. Custom synthesis is available. Send your inquiries for more information. | London |
| Di-docosahexaenoyl (C22:6)-bis(monoacyl-gylcerol) Phosphate | Di-docosahexaenoyl (C22:6)-bis(monoacyl-gylcerol) Phosphate is used as a biomarker for drug induced bio-synthesis. Group: Pharmaceutical. Alternative Names: Di-22:6-BMP (racemic mixture); 1,?1'-[Phosphinicobis[oxy(?2-hydroxy-3,?1-propanediyl)?]?]-4,?7,?10,?13,?16,?19-Docosahexaenoate; (4Z,4'Z,7Z,7'Z,10Z,10'Z,13Z,13'Z,16Z,16'Z,19Z,19'Z)-((Hydroxyphosphoryl)bis(oxy))bis(2-hydroxypropane-3,1-diyl)bis(docosa-4,7,10,13,16,19-hexaenoate). CAS No. 1252006-84-0. Pack Sizes: 1 mg. Product ID: B1370-098961. Molecular formula: C50H75O10P. Mole weight: 867.11. Custom synthesis is available. Send your inquiries for more information. | London |
| Didymin | Neoponcirin is a flavonoid that was shown to exhibit anticancer properties by inducing apoptosis by inhibiting N-Myc and upregulating RKIP in neuroblastoma. Group: Pharmaceutical. Alternative Names: Didymine; Isosakuranetin-7-O-rutinoside; Isosakuranetin-7-beta-rutinoside; Neoponcirin; (S)-7-[[6-O-(6-Deoxy-α-L-mannopyranosyl)-β-D-glucopyranosyl]oxy]-2,3-dihydro-5-hydroxy-2-(4-methoxyphenyl)-4H-1-benzopyran-4-one; (2S)-7-[[6-O-(6-Deoxy-α-L-mannopyranosyl)-β-D-glucopyranosyl]oxy]-2,3-dihydro-5-hydroxy-2-(4-methoxyphenyl)-4H-1-benzopyran-4-one; Flavanone, 5,7-dihydroxy-4'-methoxy-, 7β-rutinoside; 4'-Methoxy-5,7-dihydroxyflavanone 7-O-rutinoside; Citrifoliol-7-O-rutinoside; Isosakuranetin 7-rutinoside. CAS No. 14259-47-3. Pack Sizes: 150 mg. Product ID: B0005-058608. Molecular formula: C28H34O14. Mole weight: 594.56. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl 2-(4-(2-(2-amino-4-oxo-4,7-dihydro-1H-pyrrolo[2,3-d]pyrimidin-5-yl)ethyl)benzamido)pentanedioate 4-methylbenzenesulfonate | An impurity of Pemetrexed, which has been approved by FDA in 2004 for the treatment of malignant pleural mesothelioma (MPM) in combination with cisplatin, a platinum-containing chemotherapeutic drug. Group: Pharmaceutical. Alternative Names: (S)-Diethyl 2-(4-(2-(2-amino-4-oxo-4,7-dihydro-3H-pyrrolo[2,3-d]pyrimidin-5-yl)ethyl)benzamido)pentanedioate 4-methylbenzenesulfonate; N-[4-[2-(2-amino-4,7-dihydro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-5-yl)ethyl]benzoyl]L-glutamic acid; 4-[2-(2-amino-4,7-dihydro-4-oxo-1H-pyrrolo[2,3-d]pyrimidin-5-yl)ethyl]benzoyl-L-glutamic acid diethyl ester p-toluenesulfonate salt. CAS No. 165049-28-5. Pack Sizes: 2.5 g. Product ID: NP3162. Molecular formula: C31H37N5O9S. Mole weight: 655.72. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl 2-acetamido-2-(4-octylphenethyl)malonate | An impurity of Fingolimod. Fingolimod is a novel immune modulator that prolongs allograft transplant survival in numerous models by inhibiting lymphocyte emigration from lymphoid organs. Group: Pharmaceutical. Alternative Names: Diethyl 2-Acetamido-2-[2-(4-octylphenylethyl)malonate; 2-(Acetylamino)-2-[2-(4-octylphenyl)ethyl]propanedioic Acid 1,3-Diethyl Ester. CAS No. 162358-08-9. Pack Sizes: 1mg;1g;10g. Product ID: NP3663. Molecular formula: C25H39NO5. Mole weight: 433.59. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl(4-hydroxyphenyl)phosphonate | Diethyl(4-hydroxyphenyl)phosphonate is a useful research chemical. Group: Pharmaceutical. Alternative Names: 4-(Diethoxyphosphinyl)phenol. CAS No. 28255-39-2. Pack Sizes: 1 g. Product ID: B1370-085640. Molecular formula: C10H15O4P. Mole weight: 230.2. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl bis(hydroxymethyl)malonate | Diethyl bis(hydroxymethyl)malonate, a chemical compound found in the pharmaceutical industry, has been found to have potential uses in the treatment of Alzheimer's disease and cancer due to its unique properties. Additionally, it plays a significant role in the synthesis of antiviral drugs, including acyclovir and ganciclovir. Its prominence in drug production highlights its importance in the medical field. Group: Pharmaceutical. Alternative Names: Diethyl 2,2-bis(hydroxymethyl)malonate; Propanedioic acid, bis(hydroxymethyl)-, diethyl ester. CAS No. 20605-01-0. Pack Sizes: 500 g. Product ID: B2699-010716. Molecular formula: C9H16O6. Mole weight: 220.22. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethylene glycol mono-methacrylate | Diethylene glycol mono-methacrylate has been utilized in the fabrication of pharmaceutical carriers designed for the regulated dissemination of pharmacological agents, notably for the management of enduring medical conditions like cancer. Group: Pharmaceutical. Alternative Names: 2-Propenoic acid, 2-methyl-, 2-(2-hydroxyethoxy)ethyl ester; PEG-2 methacrylate. CAS No. 2351-43-1. Pack Sizes: 500 mg. Product ID: B1370-007519. Molecular formula: C8H14O4. Mole weight: 174.19. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethylethanolamine Dicyclohexylketone | Diethylethanolamine Dicyclohexylketone is an impurity of Dicyclomine, which is an M1 and M2 muscarinic acetylcholine receptor antagonist. Group: Pharmaceutical. CAS No. 2731926-17-1. Pack Sizes: 100 mg. Product ID: B1370-286446. Molecular formula: C19H35NO2. Mole weight: 309.49. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl malonate-[1,2,3-13C3] | Diethyl malonate-[1,2,3-13C3] is a labelled compound of Diethyl Malonate. Acylation of diethyl malonate using magnesium chloride and triethylamine is reported. Group: Pharmaceutical. Alternative Names: 13C Labeled diethyl malonate; 13C Labeled diethyl malonic acid; Malonic acid diethyl ester-13C3. CAS No. 53051-81-3. Pack Sizes: 1 g. Product ID: BLP-011108. Molecular formula: C4[13C]3H12O4. Mole weight: 163.15. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethylmethyl(2-methoxyethyl)ammonium bis(trifluoromethylsulfonyl)imide | Diethylmethyl(2-methoxyethyl)ammonium bis(trifluoromethylsulfonyl)imide. Group: Pharmaceutical. Alternative Names: N,N-Diethyl-N-methyl-N-(2-methoxyethyl)ammonium bis(trifluoromethanesulfonyl)imide. CAS No. 464927-84-2. Pack Sizes: 5 g. Product ID: B2699-189240. Molecular formula: C10H20F6N2O5S2. Mole weight: 426.4. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethylphosphinic acid | Diethylphosphinic acid, a versatile compound, is a pivotal component in organic synthesis. Owing to its remarkable capability to act as a ligand in metal-catalyzed reactions, it accentuates molecular designing. Its scope has been broadened to pharmaceuticals too, where it is researched for its prospective utilization as a pain therapy and to eradicate inflammation among patients featuring neuropathic ailments. Group: Pharmaceutical. Alternative Names: diethyl-phosphinic acid; Phosphinic acid, P,P-diethyl-. CAS No. 813-76-3. Pack Sizes: 100 mg. Product ID: B0001-084500. Molecular formula: C4H11O2P. Mole weight: 122.1. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyl Tenofovir | One impurity of Tenofovir, which is an acyclic phosphonate nucleotide derivative, could be used in antiviral treatment as an everse transcriptase inhibitor. Group: Pharmaceutical. Alternative Names: (R)-9-[2-(Diethylphosphonomethoxy)propyl] Adenine; P-[[(1R)-2-(6-Amino-9H-purin-9-yl)-1-methylethoxy]methyl]phosphonic Acid Diethyl Ester; [[(1R)-2-(6-Amino-9H-purin-9-yl)-1-methylethoxy]methyl]phosphonic Acid Diethyl Ester. CAS No. 180587-75-1. Pack Sizes: 100 mg. Product ID: B1707-234697. Molecular formula: C13H22N5O4P. Mole weight: 343.33. Custom synthesis is available. Send your inquiries for more information. | London |
| Diethyltoluamide | Diethyltoluamide is the most common active ingredient in many insect repellent products. Diethyltoluamide is also an effective solvent and may dissolve plastics, rayon, spandex, other synthetic fabrics and painted or varnished surfaces. Group: Pharmaceutical. Alternative Names: DEET; N,N-Diethyl-m-toluamide; 3-Methyl-N,N-diethylbenzamide; Metadelphene; Delphene; Flypel. CAS No. 134-62-3. Pack Sizes: 1mg;1g;10g. Product ID: 134-62-3. Molecular formula: C12H17NO. Mole weight: 191.27. Custom synthesis is available. Send your inquiries for more information. | London |
| Difelikefalin | Difelikefalin is an analgesic opioid peptide acting as a peripherally specific, highly selective agonist of the κ-opioid receptor (KOR). It acts as an analgesic by activating KORs on peripheral nerve terminals and KORs expressed by certain immune system cells. It may be useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. It is under development by Cara Therapeutics as an intravenous agent for the treatment of postoperative pain. It lacks the central side effects due to its peripheral selectivity. It is also being investigated for the treatment of pruritus (itching). It has completed phase II clinical trials for postoperative pain and has demonstrated significant and "robust" clinical efficacy, along with being safe and well-tolerated. It is also in phase II clinical trials for uremic pruritus in hemodialysis patients. Uses: Difelikefalin may be useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. it is used as an intravenous agent for the treatment of postoperative pain. it is also being investigated for the treatment of pruritus (itching). Group: Pharmaceutical. Alternative Names: N1-(D-Phenylalanyl-D-phenylalanyl-D-leucyl-D-lysyl)-4-amino-4-piperidinecarboxylic acid; CR 845; D-Phe-D-Phe-D-Leu-D-Lys-[gamma-(4-N-piperidinyl)amino carboxylic acid]; 1-(D-Phenylalanyl-D-phenylalanyl-D-leucy | London |
| Difenamizole | Difenamizole is a non-steroidal anti-inflammatory drug (NSAID) and analgesic of the pyrazolone group related to metamizole. Group: Pharmaceutical. Alternative Names: 2-(dimethylamino)-N-(2,5-diphenylpyrazol-3-yl)propanamide; Difenamizole; Difenamizole [INN]; Difenamizolum; BRN 0698538; Diphenamizole; Pasalin; UNII-24MR6YLL3W; BRN-0698538; BRN0698538. CAS No. 20170-20-1. Pack Sizes: 1mg;1g;10g. Product ID: 20170-20-1. Molecular formula: C20H22N4O. Mole weight: 334.415. Custom synthesis is available. Send your inquiries for more information. | London |
| Difethialone | Difethialone is an anticoagulant used as an rodenticide. Group: Pharmaceutical. Alternative Names: 3-[3-[4-(4-bromophenyl)phenyl]-1,2,3,4-tetrahydronaphthalen-1-yl]-2-hydroxythiochromen-4-one. CAS No. 104653-34-1. Pack Sizes: 1mg;1g;10g. Product ID: 104653-34-1. Molecular formula: C31H23BrO2S. Mole weight: 539.487. Custom synthesis is available. Send your inquiries for more information. | London |
| Difloxacin-[d3] Hydrochloride | Difloxacin-[d3] Hydrochloride is a labelled Difloxacin hydrochloride, which is a fluoroquinolone antibiotic commonly used in veterinary medicine. Group: Pharmaceutical. Alternative Names: Difloxacin D3 Hydrochloride. CAS No. 1173021-89-0. Pack Sizes: 10 mg. Product ID: BLP-012314. Molecular formula: C21H17D3ClF2N3O3. Mole weight: 438.87. Custom synthesis is available. Send your inquiries for more information. | London |
| Difloxacin Hydrochloride | A fluoroquinolone antibiotic commonly used in veterinary medicine. It is an inhibitor of Topo II. Group: Pharmaceutical. Alternative Names: 6-Fluoro-1-(4-fluorophenyl)-1,4-dihydro-7-(4-methylpiperazino)-4-oxo-3-quinolinecarboxylic acid hydrochloride; Difloxacin HCl. CAS No. 91296-86-5. Pack Sizes: 1mg;1g;10g. Product ID: BBF-04642. Molecular formula: C21H19F2N3O3.HCl. Mole weight: 435.85. Custom synthesis is available. Send your inquiries for more information. | London |
| Diflubenzuron | Diflubenzuron is a benzoylurea-type insecticide of the benzamide class. The mechanism of action of diflubenzuron involves inhibiting the production of chitin which is used by an insect to build its exoskeleton. Group: Pharmaceutical. Alternative Names: Difluron; Dimilin; Larvakil; N-[(4-chlorophenyl)carbamoyl]-2,6-difluorobenzamide. CAS No. 35367-38-5. Pack Sizes: 1mg;1g;10g. Product ID: 35367-38-5. Molecular formula: C14H9ClF2N2O2. Mole weight: 310.685. Custom synthesis is available. Send your inquiries for more information. | London |
| Difopein | Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Group: Pharmaceutical. Alternative Names: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG. CAS No. 396834-58-5. Pack Sizes: 1 mg. Product ID: BAT-010334. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17. Custom synthesis is available. Send your inquiries for more information. | London |
| Diglycidyl Terephthalate | Diglycidyl Terephthalate (DGT) is a monomeric compound utilized for producing high-thermal resistant polymers. As a cross-linking agent in polymerization reactions, DGT generates robust materials with exceptional stability and durability. Furthermore, its multifunctional properties make it ideal for developing composite materials, particularly in the aerospace and industrial sectors. The capability of DGT to enhance the overall performance of materials is significant, and its applications are diverse. Group: Pharmaceutical. Alternative Names: Bis(2,3-epoxypropyl) terephthalate; Terephthalic acid diglycidyl ester. CAS No. 7195-44-0. Pack Sizes: 500 mg. Product ID: B2699-315506. Molecular formula: C14H14O6. Mole weight: 278.26. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydroajugapitin | Dihydroajugapitin is a diterpenoid compound isolated from the herbs of Ajuga ciliata Bunge. Group: Pharmaceutical. Alternative Names: 14,15-Dihydroajugapitin; (1R,2S,3R,4aR,5S,6R,8S,8aR)-8-Acetoxy-8a-(acetoxymethyl)-5-[(2S,3aR,6aS)-hexahydrofuro[2,3-b]furan-2-yl]-3-hydroxy-5,6-dimethyloctahydro-2H-spiro[naphthalene-1,2'-oxiran]-2-yl (2S)-2-methylbutanoate. CAS No. 87480-84-0. Pack Sizes: 5 mg. Product ID: NP1672. Molecular formula: C29H44O10. Mole weight: 552.7. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydroalpinumisoflavone | Dihydroalpinumisoflavone is a flavonoid derivative isolated from the herbs of Erythrina arborescens. Uses: Antibacterial. Group: Pharmaceutical. Alternative Names: 5-Hydroxy-7-(4-hydroxyphenyl)-2,2-dimethyl-3,4-dihydro-2H,6H-pyrano[3,2-g]chromen-6-one. CAS No. 63807-90-9. Pack Sizes: 5 mg. Product ID: NP2447. Molecular formula: C20H18O5. Mole weight: 338.4. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydroartemisinin | Dihydroartemisinin is an anti-malarial agent. It is a metabolite of Artemisinin. Group: Pharmaceutical. Alternative Names: 3,12-Epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol, decahydro-3,6,9-trimethyl-, (3R,5aS,6R,8aS,9R,10S,12R,12aR)-; (3R,5aS,6R,8aS,9R,10S,12R,12aR)-Decahydro-3,6,9-trimethyl-3,12-epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol; 3,12-Epoxy-12H-pyrano[4,3-j]-1,2-benzodioxepin-10-ol, decahydro-3,6,9-trimethyl-, [3R-(3α,5aβ,6β,8aβ,9α,10α,12β,12aR*)]-; Alaxin; Artemisinin deriv. DHA; Artenimol; CID 3000518; Cotecxin; Cotexin; DHA; DHQHS 2; Dihydroartemisinine; Dihydroqinghaosu; Dynamax; HC 101C; Salaxin; Santecxin; β-Dihydroartemisinin. CAS No. 71939-50-9. Pack Sizes: 1mg;1g;10g. Product ID: NP5947. Molecular formula: C15H24O5. Mole weight: 284.35. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydro-Axitinib | Dihydro-Axitinib is an impurity of Axitinib, a tyrosine kinase inhibitor used for the treatment of kidney cancer. Group: Pharmaceutical. CAS No. 1443118-73-7. Pack Sizes: 10 mg. Product ID: B1370-467094. Molecular formula: C22H20N4OS. Mole weight: 388.49. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydroberberine | Dihydroberberine, isolated from the tubers of Corydalis decumbens (Thunb.) Pers, was identified that displayed improved in vivo efficacy in terms of counteracting increased adiposity, tissue triglyceride accumulation, and insulin resistance in high-fat-fed rodents. It is also a potential therapeutic reagent for type 2 diabetes treatment. Uses: Anti-tumor. Group: Pharmaceutical. Alternative Names: 5,8-Dihydro-9,10-dimethoxy-6H-benzo[g]-1,3-benzodioxolo[5,6-a]quinolizine; 9,10-Dimethoxy-2,3-(methylenedioxy)-13,13a-didehydroberbine; Dihydroumbellatine; 9,10-DiMethoxy-6,8-dihydro-5H-[1,3]dioxolo[4,5-g]isoquinolino[3,2-a]isoquinoline; Dihydroumbellatine. CAS No. 483-15-8. Pack Sizes: 10 mg. Product ID: B2703-465605. Molecular formula: C20H19NO4. Mole weight: 337.36. Custom synthesis is available. Send your inquiries for more information. | London |
| Dihydro Capsaicin | Dihydro Capsaicin is a terpene alkaloid found in Capsicum. Uses: Sterilization. Group: Pharmaceutical. Alternative Names: Dihydrocapsaicin; 6,7-Dihydrocapsaicin; N-(4-hydroxy-3-methoxybenzyl)-8-methylnonanamide; 8-Methyl-N-vanillylnonanamide. CAS No. 19408-84-5. Pack Sizes: 250 mg. Product ID: B2703-465114. Molecular formula: C18H29NO3. Mole weight: 307.43. Custom synthesis is available. Send your inquiries for more information. | London |
Would you like to list your products on UK Chemical Suppliers?
Our database is helping our users find suppliers everyday.